Abstract

ABSTRACT  Certain short polycations, such as TAT and oligoarginine, rapidly pass through the plasma membranes of mammalian cells by a mechanism called transduction, as well as by endocytosis and macropinocytosis. These cell-penetrating peptides (CPPs) can carry with them cargos of 30 amino acids, more than the nominal limit of 500 Da and enough to be therapeutic. An analysis of the electrostatics of a charge outside the cell membrane and some recent experiments suggest that transduction may proceed by molecular electroporation. Ways to target diseased cells, rather than all cells, are discussed.

I The Problem of Drug Delivery

We could cure cancer if we knew how to deliver a drug intact to the cytosol of every cancer cell, sparing healthy cells. The circulatory system can deliver a drug to every cell in the body, and certain chemical tricks protect drugs from peptidases (Chorev and Goodman, 1993) and nucleases (Manoharan et al., 2005). But it’s harder to cope with antibodies, spare healthy tissues, and get drugs past the plasma membrane, which blocks or endocytoses molecules in excess of 500 Da (Lipinski et al., 1997).

This paper is about cell-penetrating peptides and other cations that can overcome the 500-Da restriction barrier and about tricks that may spare healthy cells. Section II describes several cell-penetrating peptides (CPPs), and section III sketches a variety of therapeutic applications of CPPs. Section IV reviews basic facts about the lipid bilayer of the eukaryotic cell. New work on the electrostatics of the bilayer is presented in section V. Section VI sketches a model (Cahill, 2009, 2010) of the transduction of polyarginine and mentions some experimental support (Herce et al., 2009) which the model has recently received. Section VII discusses a broader class of cell-penetrating molecules and suggests ways to target cancer cells.

II Cell-Penetrating Peptides

In 1988, two groups (Green and Loewenstein, 1988; Frankel and Pabo, 1988) working on HIV reported that the trans-activating transcriptional activator (TAT) of HIV-1 can cross cell membranes. The engine driving this 86-aa cell-penetrating peptide (CPP) is residues 48–57 grkkrrqrrr which carry a charge of +8$e$. Other CPPs were soon found. Antp (aka Penetratin, PEN) is residues 43–58 rqikiwfqnrrmkwkk of Antennapedia, a homeodomain of the fly; it carries a charge of +7$e$. The polyarginine Rⁿ carries charge $+ne$, where often $n=7,8$, or 9. Other CPPs have been discovered (VP22) or synthesized (transportan). The structural protein VP22 of the tegument of herpes simplex virus type 1 (HSV-1) has charge +15$e$. Transportan gwtlnsagyllg-k-inlkalaalakkil-amide is a chimeric peptide constructed from the 12 N-terminal residues of galanin in the N-terminus with the 14-residue sequence of mastoparan and a connecting lysine (Lindberg et al., 2001). With its terminal amide group, its charge is +5$e$.

These and other short, positively charged peptides can penetrate the plasma membranes of live cells and can tow along with them cargoes that greatly exceed the 500 Da restriction barrier. They are promising therapeutic tools when towing cleverly chosen peptide cargoes of from 8 to 33 amino acids (Jiang et al., 2004; Snyder et al., 2005; Willam et al., 2002; Chen et al., 1999; Mendoza et al., 2003; Harbour et al., 2002; Mai et al., 2001; Datta et al., 2001; Hosotani et al., 2002; Zhou et al., 2006; Snyder et al., 2004; Haase et al., 2006; Tünnemann et al., 2007).

Many early experiments on CPPs were wrong because the cells were fixed or insufficiently washed. Even careful experiments sometimes have yielded inconsistent results—in part because fluorescence varies with the (sub)cellular conditions and the fluorophores (Ziegler and Seelig, 2007).

Yet some clarity is emerging: TAT carries cargoes across cell membranes with high efficiency by at least two functionally distinct mechanisms according to whether the cargo is big or small (Tünnemann et al., 2006). Big cargoes, such as proteins or quantum dots, enter via caveolae endocytosis and macropinocytosis (Wadia et al., 2004; Duchardt et al., 2007), and relatively few escape the cytoplasmic vesicles in which they then are trapped (Tünnemann et al., 2006).

Small cargoes, such as peptides of fewer than 30–40 amino acids, enter both slowly by endocytosis and rapidly by transduction with direct access to the cytosol, an unknown mechanism that uses the membrane potential (Tünnemann et al., 2006; Prochiantz, 2000; Dom et al., 2003; Rothbard et al., 2005; Zaro and Shen, 2005). Peptides fused to TAT enter cells within seconds (Ziegler et al., 2005).

It remains unclear how big cargoes aided by several CPPs enter cells (Patel et al., 2007). For instance, superparamagnetic nanoparticles encased in aminated dextran and attached to 45 tat peptides are thought to enter cells by adsorptive endocytosis(Fawell et al., 1994; Nagahara et al., 1998; Bulte, 2006) but they do enter slowly at 4^∘ C (Garden et al., 2006).

III Therapeutic Applications

The use of a cell-penetrating peptide (CPP) to carry into cells a biologically active peptide of up to some 35 amino acids (aa) allows for $20^{35}=3\times 10^{45}$ different peptides and may lead to strikingly smart drugs, some of which may selectively target tumor cells (Jiang et al., 2004). I will now briefly describe 11 promising advances toward this goal of cell-penetrating-peptide drugs (CPPDs).

The CXC chemokine receptor 4 (CXCR4) is overexpressed in $>\!\!\,\!\,20$ types of cancer, including prostate, breast, colon, and small-cell lung cancer. Snyder et al. (Snyder et al., 2005) attached the CXCR4 ligand DV3 to the CPP TAT and then either to a Cdk2-antagonist peptide (DV3-TAT-RxL) or to a p53-activating peptide (DV3-$\{$TAT-p53C’$\}_{ri}$) in which ri means retroinverso (Chorev and Goodman, 1993). The DV3+RxL and DV3+p53C’ cargoes respectively consisted of 19 and 33 aa. Both ligand-guided CPPs were more than twice as effective as unguided CPPs in killing CXCR4 expressing Namalwa lymphoma cells.

The transcription factor hypoxia-inducible factor-1 (HIF), a master regulator of the hypoxic response, is itself regulated thru the oxygen-dependent degradation domains (ODD) of its $\alpha$-chains (HIF$\alpha$). The NODD and CODD peptides respectively are the amino- and carboxyl-terminal sequences of ODD. Pugh et al. injected TAT fused to CODD (tat-CODD) into sponges implanted subcutaneously (s.c.) in mice. After 7 days, they found that tat-CODD but not the control mutant tat-CODD${}^{\mbox{mut}}$ produced blood vessels of increasing density and complexity (Willam et al., 2002). Their results for tat-NODD were similar. Thus TAT delivery of NODD and CODD peptides can stimulate angiogenesis and may lead to therapies for ischemic diseases. The cargoes NODD and CODD respectively were 28 and 19 aa long.

If the DNA-binding ability of the transcription factor E2F1 is not curtailed as cells traverse and prepare to exit S phase, then apoptosis is likely. In normal cells, the retinoblastoma tumor-suppressor protein pRB converts E2Fs from activators to repressors of transcription. But pRB often is not present in transformed cells. Cyclin A/cdk2 also neutralizes E2F1’s DNA-binding ability. So if one blocked the interaction of cyclin A/cdk2 and E2F1 in cells, then the transcription factor E2F1 would continue to activate transcription after exit from S phase in cancer cells but not in normal cells equipped, as they are, with pRB. Apoptosis then would occur in the transformed cells but not in the normal ones. Chen et al. (Chen et al., 1999) used TAT and PEN to carry the synthetic peptides pvkrrlfg and pvkrrldl, which block the interaction of cyclin A/cdk2 and E2F1, into U2OS osteosarcoma cells, T-antigen-transformed WI38/VA13 cells, and healthy WI38 cells. They found that apoptosis occurred in and only in the cancer cells (Chen et al., 1999). Both cargoes were 8 aa long.

The CPPD PEN-pvkrrldl injected in and near tumors in nude mice that had been s.c. injected with SVT2 cells with altered cyclin D/Rb pathways produced large areas of apoptosis and necrosis, particularly at the tumor periphery (Mendoza et al., 2003). PEN-pvkrrlfg had similar effects on herceptin-resistant mammary tumors from HER2 transgenic mice implanted in syngeneic FVB mice (Mendoza et al., 2003). Both cargoes were 8 aa long.

HDM2 binds and inhibits p53, keeping it at low levels in normal cells. Oncogenic mutations disrupt this HDM2-p53 equilibrium, allowing p53 to accumulate and induce stasis or apoptosis. In most cancer cells, p53 is mutated or HDM2 is overexpressed. Uveal melanomas (common eye cancers in adults) overexpress HDM2. A peptide that blocks HDM2 may liberate p53, which may induce apoptosis in cancer cells but remain inactive in normal ones. The sequence qetfsdlwkllp ($\alpha$HDM2) of the p53 binding site for HDM2 blocks HDM2. TAT-G-$\alpha$HDM2 at concentrations of 200–300 $\mu$M induces apoptosis in MM-23, MM-24, & MM-26 uveal, Y79 & WERI retinoblastoma, U2OS osteosarcoma, and C33A cervical cancer cells with little effect on normal cells (Harbour et al., 2002). Injection of $10^{7}$ WERI human retinoblastoma cells produced intraocular tumors in the anterior chambers of rabbit eyes. But the injection of TAT-$\alpha$HDM2 (intraocular concentration 200 $\mu$M) began to dissolve the tumors into a fine cloud within 24 hours. A second injection reduced the viable tumor mass by 76% within 72 hours with no histologic damage to other ocular tissues. The cargo was 13 aa long.

The CPP rrqrrtsklmkr (“PTD-5,” charge +7$e$) joined to the antimicrobial peptide klaklakklaklak (“KLA”) with a diglycine spacer forms the pro-apoptotic peptide PTD-5-GG-KLA (“DP1”). Robbins et al. injected 50 $\mu$L of 1 mm DP1 or KLA for 11 days into C57BL/6 mice with single-flank, day-12 MCA205 fibrosarcomas. After only 8 days of treatment, DP1 but not KLA had shrunk the tumors. DP1 but not KLA or PTD-5 activated caspase-3 and mediated apoptosis (Mai et al., 2001). The cargo was 16 aa.

Renal-cell cancer (RCC) is the seventh most common and is resistant to non-surgical therapies. Sporadic clear-cell renal cancer often exhibits functional inactivation of the protein pVHL of the von-Hippel-Lindau (VHL) gene. Residues 104–123 of a $\beta$-sheet of pVHL inhibits the IGF-I signaling upon which RCC is dependent (Datta et al., 2001). Daily intraperitioneal injections of 2 nmol of TAT-FLAG-pVHL(104–123) arrested and then reduced tumors of 786-O RCC cells in nude mice, while TAT-FLAG had no effect. (FLAG is the antigen ykddddk.) The cargo was 27 aa long.

The tumor-suppressor gene 16INK4A often is inactivated by intragenic mutation, homozygous deletion, or methylation silencing in many human cancers, especially pancreatic cancer. Its protein p16 inhibits the phosphorylation of Rb by cdk-4 and by cdk-6, and so p16 blocks the G₁$\to$S phase transition. Residues 84–103 of p16 are sufficient to block this transition. The Trojan p16 peptide was p16(84–103)C linked by a disulfide bond to C-Antp: daaregfldtlvvlhragarc-crqikiwfqnrrmkwkk. Trojan p16 (i.p. 100 $\mu$g/mouse/day) reduced AsPC-1 and BxPC-3 s.c. tumors respectively by factors of 2 and 5 without hematological cytotoxicity or body weight loss (Hosotani et al., 2002). The cargo was 22 aa long.

The DOC-2/DAB2 (differentially expressed in ovarian cancer-2/disabled 2) protein often is lost in prostate cancer. As part of the homeostatic machinery in the normal prostate epithelium, DOC-2/DAB2 modulates the Grb2-SOS-MAPK signal axis. The small peptide fqlrqpplvpsrkge is less immunogenic than the protein DOC-2/DAB2 but still has some of its ability to interact with SH3 domains. Hsieh et al. used the CPP R11 to carry this peptide into cells. The CPPD r¹¹-ggg-fqlrqpplvpsrkge at 5 $\mu$M for 3 hours inhibited the growth of LNCaP and C4-2 prostate-cancer cells. (Zhou et al., 2006) The cargo was 18 aa long.

The peptide p53C^′, derived from the K-rich C-terminal domain of p53, activates specific DNA binding by p53, activates wild-type p53, restores function to several p53 contact mutants, and induces apoptosis or G₁ growth arrest in cancer cells but not in normal ones (Snyder et al., 2004). The retro-inverso (Chorev and Goodman, 1993) D-isomer TAT-p53C${}^{\prime}_{ri}$ rrrqrrkkrgygkkhrstsqgkksklhssharsg resists proteolysis better than the L-isomer p53C^′-TAT. TAT-p53C${}^{\prime}_{ri}$ induces G₁ cell-cycle arrest and senescence better than p53C^′-TAT in murine TA3/St mammary cancer cells, which express wild-type p53, and induces the transcription of p53 from a wild-type p53 expression vector in p53-null, H1299 lung-cancer cells (Snyder et al., 2004). Injections (i.p.) of 600 $\mu$g of TAT-p53C${}^{\prime}_{ri}$ once a day for 12 days inhibited solid-tumor growth in mice and led to a 6-fold increase in longevity in mice with terminal peritoneal carcinomatosis. Sixteen injections (i.p.) of 900 $\mu$g of TAT-p53C${}^{\prime}_{ri}$ over 20 days cured 50% of mice with terminal peritoneal lymphoma (Snyder et al., 2004). The cargo was 23 aa long.

Residues 1–15 of the human ventricular myosin light chain-1 (VLC-1) binds to actin, targets the actin/MLC-1 interaction, and improves the contraction of isolated perfused hearts (Haase et al., 2006). VLC-1 fused to TAT entered adult cardiomyocytes with high efficiency, accumulated in the actin-containing I-band of their sarcomeres, and enhanced their contractility without changing their myoplasmic Ca²⁺ levels (Tünnemann et al., 2007). The cargo was 15 aa long.

In these transduction experiments, the heaviest cargo was 33 amino acids. In my somewhat casual literature search, I found no biomedical articles describing the transduction of heavier cargoes. In the biophysical experiments, the cargoes respectively were 20, 22, and 26 aa (apart from a tiny rhodamine tag) (Tünnemann et al., 2006), and just a $\sim\!\,$400 Da fluorophore (Tünnemann et al., 2008).

IV Mammalian Plasma Membranes

The plasma membrane of a mammalian cell is a lipid bilayer that is 4 or 5 nm thick. Of the four main phospholipids in it, three—phosphatidylethanolamine (PE), phosphatidylcholine (PC), and sphingomyelin (SM)—are neutral, and one, phosphatidylserine (PS), is negatively charged. In live cells, PE and PS are mostly in the cytosolic layer, and PC and SM in the outer layer (Bevers et al., 1999; Alberts et al., 2002). Aminophospholipid translocase (flippase) moves PE and PS to the inner layer; floppase slowly moves all phospholipids to the outer layer (Bevers et al., 1999).

Glycolipids make up about 5% of the lipid molecules of the outer layer of a mammalian plasma membrane where they may form lipid rafts. Their hydrocarbon tails normally are saturated. Instead of a modified phosphate group, they are decorated with galactose, glucose, GalNAc = N-acetylgalactosamine, and other sugars. The most complex glycolipids—the gangliosides—have negatively charged sialic-acid (NANA) groups.

A living cell maintains an electrostatic potential of between 20 and 120 mV across its plasma membrane. The electric field $E$ within the membrane points into the cell and is huge, about 15 mV/nm or $1.5\times 10^{7}$ V/m if the potential difference is 60 mV across a membrane of 4 nm. Conventionally, one reports membrane potentials as the electric potential inside the cell minus that outside, so that here $\Delta V=-60$ mV. Near but outside the membrane, this electric field falls-off exponentially $E(r)=E\,\exp(-r/D_{\ell})$ with the ratio of the distance $r$ from the membrane to the Debye length $D_{\ell}$, which is of the order of a nanometer. The rapid entry of TAT fused to peptides is frustrated only by agents that destroy the electric field $E$ (Tünnemann et al., 2006).

Most of the phospholipids of the outer leaflet of the plasma membrane are neutral PCs & SMs. They vastly outnumber the negatively charged gangliosides, which are a subset of the glycolipids, which themselves amount only to 5% of the outer layer. Imagine now that polyarginine-cargo molecules are in the extra-cellular environment. Many of them will be pinned down by the electric field $E(r)$ just outside the membrane, their positively charged guanidinium groups interacting with the negative phosphate groups of neutral dipolar PC & SM head groups (Rothbard et al., 2005). (Other CPP-cargo molecules will stick to negatively charged gangliosides and to glycosaminoglycans (GAGs) attached to transmembrane proteoglycans (PGs); these slowly will be endocytosed. PGs with heparan-sulfate GAGs are needed for TAT-protein endocytosis (Tyagi et al., 2001).) It is crucial that the dipolar PC & SM head groups are neutral and so do not cancel or reduce the positive electric charge of a CPP-cargo molecule. The net positive charge of a CPP-cargo molecule and the negatively charged PSs under it on the inner leaflet form a kind of capacitor.

V Membrane Electrostatics

A recent calculation (Cahill, 2010) of the electrostatic potential due to a charge outside the phospholipid bilayer of a eukaryotic cell shows how effectively this plasma membrane insulates the cell from external charges.

The electrostatic potential in the lipid bilayer $V_{\ell}(\rho,z)$ due to a charge $q$ at the point $(0,0,h)$ on the $z$-axis, a height $h$ above the interface between the lipid bilayer and the extra-cellular environment, is

$$V_{\ell}(\rho,z) = \frac{q}{4\pi\epsilon_{0}\epsilon_{w\ell}}\,\sum_{n=0}^{\infty}(pp^{\prime})^{n}\left(\frac{1}{\sqrt{\rho^{2}+(2nt+h-z)^{2}}}\right.$$ (1)

$$\left.\mbox{}-\frac{p^{\prime}}{\sqrt{\rho^{2}+(2(n+1)t+h+z)^{2}}}\right)$$

in which $t$ is the thickness of the lipid bilayer, $\epsilon_{w\ell}=(\epsilon_{w}+\epsilon_{\ell})/2$ is average of the relative permittivities of the extra-cellular fluid $\epsilon_{w}$ and the lipid bilayer $\epsilon_{\ell}$, and $p$ and $p^{\prime}$ are the ratios

$$p=\frac{\epsilon_{w}-\epsilon_{\ell}}{\epsilon_{w}+\epsilon_{\ell}}\quad\mbox{and}\quad p^{\prime}=\frac{\epsilon_{c}-\epsilon_{\ell}}{\epsilon_{c}+\epsilon_{\ell}}$$ (2)

which lie between 0 and 1, $\epsilon_{c}$ being the relative permittivity of the cytosol (Cahill, 2010). The potential in the extra-cellular medium is

$$V_{w}(\rho,z) = \frac{q}{4\pi\epsilon_{0}\epsilon_{w}}\left(\frac{1}{r}+\frac{p}{\sqrt{\rho^{2}+(z+h)^{2}}}\right.$$ (3)

$$\mbox{}-\left.\frac{\epsilon_{w}\epsilon_{\ell}}{\epsilon_{w\ell}^{2}}\sum_{n=1}^{\infty}\frac{p^{n-1}p^{\prime n}}{\sqrt{\rho^{2}+(z+2nt+h)^{2}}}\right)$$

in which $r=\sqrt{\rho^{2}+(z-h)^{2}}$ is the distance from the charge $q$ (Cahill, 2010). The potential in the cytosol due to the same charge $q$ is

$$V_{c}(\rho,z)=\frac{q\,\epsilon_{\ell}}{4\pi\epsilon_{0}\epsilon_{w\ell}\epsilon_{\ell c}}\!\sum_{n=0}^{\infty}\frac{(pp^{\prime})^{n}}{\sqrt{\rho^{2}+(2nt+h-z)^{2}}}.$$ (4)

where $\epsilon_{\ell c}$ is the mean relative permittivity $\epsilon_{\ell c}=(\epsilon_{\ell}+\epsilon_{c})/2$ (Cahill, 2010).

If one seeks the potential only directly above or below the charge, that is, for $\rho=0$, then these formulas become simpler and may be expressed in terms of the Lerch transcendent

$$\Phi(z,s,\alpha)=\sum_{n=0}^{\infty}\frac{z^{n}}{(n+\alpha)^{s}}.$$ (5)

For $\rho=0$, the potential is

$$V_{\ell}(0,z) = \frac{q}{4\pi\epsilon_{0}\epsilon_{w\ell}}\,\sum_{n=0}^{\infty}(pp^{\prime})^{n}\left(\frac{1}{2nt+h-z}\right.$$ (6)

$$\left.\mbox{}-\frac{p^{\prime}}{2(n+1)t+h+z}\right)$$

$$= \frac{q}{8\pi\epsilon_{0}\epsilon_{w\ell}t}\,\left[\Phi\left(pp^{\prime},1,\frac{h-z}{2t}\right)\right.$$

$$\left.\mbox{}-p^{\prime}\Phi\left(pp^{\prime},1,1+\frac{h+z}{2t}\right)\right]$$

in the lipid bilayer,

$$V_{w}(0,z) = \frac{q}{4\pi\epsilon_{0}\epsilon_{w}}\left[\frac{1}{|z-h|}+\frac{p}{z+h}\right.$$

$$\left.\mbox{}-\frac{\epsilon_{w}\epsilon_{\ell}}{\epsilon_{w\ell}^{2}p}\left(\frac{1}{2t}\Phi(pp^{\prime},1,\frac{z+h}{2t})-\frac{1}{z+h}\right)\right]$$

in the extracellular environment, and

$$V_{c}(0,z)=\frac{q\,\epsilon_{\ell}}{8\pi\epsilon_{0}\epsilon_{w\ell}\epsilon_{\ell c}t}\Phi(pp^{\prime},1,\frac{h-z}{2t}).$$ (8)

in the cytosol.

In and near the extracellular region, these potentials are fairly well approximated by the simple formulas

$$V_{w}(0,z) \approx \frac{q}{4\pi\epsilon_{0}\epsilon_{w}}\left(\frac{1}{|z-h|}+\frac{p}{z+h}\right)$$ (9)

$$V_{\ell}(0,z) \approx \frac{q}{4\pi\epsilon_{0}\epsilon_{wl}\,|z-h|}$$ (10)

which hold when the lipid bilayer is infinitely thick. But the potential $V_{\ell}(0,z)$ drops significantly below the simple formula (10) as $z$ descends deeper into the bilayer and nearly vanishes at the lipid-cytosol interface as does $V_{c}(0,z)$ in the cytosol.

Figure 1: The potentials (6–8) above, $V_{w}(0,z)$ (blue), and below, $V_{\ell}(0,z)$ (red) and $V_{c}(0,z)$ (blue), a unit charge $q=|e|$ at $(\rho,z)=(0,0)$ are plotted for a lipid bilayer of thickness $t=5$ nm. The green dotted curve follows the simple approximation (10).

Figure 2: The potentials (V, 6, & 8) above $V_{w}(0,z)$ (blue) and below $V_{\ell}(0,z)$ (red) and $V_{c}(0,z)$ (blue) a unit charge $q=|e|$ at $(\rho,z)=(0,0)$ are plotted for lipid bilayers of thickness $t=2$, 3, 4, and 5 nm. Note that the potential at the interface between the cytosol and the bilayer is less than a tenth of $kT$ even for a bilayer as thin as 2 nm.

For a unit charge $q=|e|$ at $(\rho,z)=(0,0)$, the potentials (6–8) are plotted in Fig. 1: $V_{w}(0,z)$ (blue), $V_{\ell}(0,z)$ (red), and $V_{c}(0,z)$ (blue). The green dotted curve follows the simple approximation (10) to $V_{\ell}(0,z)$. The potential $V_{\ell}(0,-t)$ at the interface between the cytosol and the bilayer is $6.6\times 10^{-4}$ V, so that a unit charge there would have an electrostatic energy (due to the charge $|e|$ at $(0,0)$) of only about $kT_{b}/40$ at body temperature.

Fig. 2 plots the potentials (6–8) due to a unit charge at $(\rho,z)=(0,0)$ for lipid bilayers of thicknesses $t=2$, 3, 4, and 5 nm. Even for a bilayer as thin as 2 nm, the potential $V_{c}(0,-t)$ directly below the charge at the interface between the cytosol and the bilayer is less than a tenth of $kT_{b}/|e|$.

These potentials and figures illustrate the extraordinary electrostatic insulation provided by the lipid bilayer.

VI Electroporation Model

VI.1 Electroporation

Somewhat paradoxically, the remarkable electrostatic insulation provided by the lipid bilayer makes membrane proteins more sensitive to charges lying outside the cell and also makes cells more vulnerable to electroporation. The reason for both of these effects is that the electric field $\bm{E}$ in the lipid bilayer due to a charge $q$ at the interface between the bilayer and the extracellular environment is

$$\bm{E}=-\left[V_{\ell}(0,0)-V_{\ell}(0,-t)\right]\,\frac{\bm{\hat{z}}}{t}$$ (11)

apart from the screening effects of counterions. Since even a charge $q=\pm 10e$ makes a potential $V_{\ell}(0,-t)$ at $z=-t$ that is less than $kT_{b}/|e|$, this electric field is approximately

$$\bm{E}\approx-V_{\ell}(0,0)\,\frac{\bm{\hat{z}}}{t}$$ (12)

which is larger than if the potential $V_{\ell}(0,-t)$ were more significant.

Electroporation is the formation of pores in membranes by an electric field. Depending on the duration of the field and the type of cell, an electric potential difference across a cell’s plasma membrane in excess of about 200 mV will create pores.

There are two main components to the energy of a pore. The first is the line energy $2\pi r\gamma$ due to the linear tension $\gamma$, which is of the order of $10^{-11}$ J/m. The second is the electrical energy $-0.5\Delta C\pi r^{2}(\Delta V)^{2}$ in which $\Delta V$ is the voltage across the membrane and $\Delta C=C_{w}-C_{\ell}$ is the difference between the specific capacity per unit area $C_{w}=\epsilon_{w}\epsilon_{0}/t$ of the water-filled pore and that $C_{\ell}=\epsilon_{\ell}\epsilon_{0}/t$ of the pore-free membrane of thickness $t$. There also is a small term due to the surface tension $\Sigma$ of the plasma membrane of the cell, but this term usually is negligible since $\Sigma$ is of the order of $2.5\times 10^{-6}$ J/m² (Dai et al., 1997). The energy of the pore in a plasma membrane is then (Abidor et al., 1979; Chernomordik et al., 1987; Glaser et al., 1988; Weaver and Chizmadzhev, 1996; Melikov et al., 2001)

$$E(r)=2\pi r\gamma-\pi r^{2}\Sigma-{\textstyle{\frac{1}{2}}}\pi r^{2}\Delta C\,(\Delta V)^{2}.$$ (13)

This energy has a maximum of

$$E(r_{c})=\frac{2\pi\gamma^{2}}{\Delta C(\Delta V)^{2}+2\Sigma}\approx\frac{2\pi\gamma^{2}}{\Delta C(\Delta V)^{2}}$$ (14)

at the critical radius

$$r_{c}=\frac{2\gamma}{\Delta C\,(\Delta V)^{2}+2\Sigma}\approx\frac{2\gamma}{\Delta C\,(\Delta V)^{2}}.$$ (15)

The chance of a pore forming rises steeply with the magnitude of the voltage and falls with the radius of the pore.

Table 1: The voltage differences $\Delta V_{CPP}+\Delta V_{NaCl}$ (mV) across the plasma membrane induced by an R^N oligoarginine as an $\alpha$-helix, a random coil, or a $\beta$-strand and by the ions of 156 mM Na⁺ and Cl^- reacting to it. The resting transmembrane potential $\mbox{}-120<\Delta V_{cell}<-20$ mV is not included.

$N$	RN $\alpha$-helix	RN random coil	RN $\beta$-strand
5	$\mbox{}-144\pm 4$	$\mbox{}-154\pm 3$	$\mbox{}-148\pm 4$
6	$\mbox{}-174\pm 4$	$\mbox{}-173\pm 4$	$\mbox{}-168\pm 1$
7	$\mbox{}-206\pm 4$	$\mbox{}-201\pm 3$	$\mbox{}-189\pm 2$
8	$\mbox{}-232\pm 3$	$\mbox{}-228\pm 1$	$\mbox{}-199\pm 5$
9	$\mbox{}-256\pm 6$	$\mbox{}-246\pm 2$	$\mbox{}-205\pm 4$
10	$\mbox{}-281\pm 2$	$\mbox{}-260\pm 5$	$\mbox{}-210\pm 4$
11	$\mbox{}-306\pm 5$	$\mbox{}-260\pm 3$	$\mbox{}-218\pm 4$
12	$\mbox{}-323\pm 4$	$\mbox{}-261\pm 4$	$\mbox{}-213\pm 2$

If the transmembrane potential $\Delta V$ is turned off before the radius of the pore reaches $r_{c}$, then the radius $r$ of the pore usually shrinks quickly (well within 1 ms (Chernomordik et al., 1987)) to a radius so small as to virtually shut-down the conductivity of the pore. This rapid closure occurs because in (13) the energy $2\pi r\gamma$ dominates over $-\pi r^{2}\Sigma$, the surface tension $\Sigma$ being negligible. Such a pore is said to be reversible. But if $\Delta V$ remains on when $r$ exceeds the critical radius $r_{c}$, then the pore usually will grow and lyse the cell; such a pore is said to be irreversible.

The formula (15) provides an upper limit on the radius of a reversible pore. This upper limit drops with the square of the transmembrane voltage $\Delta V$ from $r_{c}=3.6$ nm for $\Delta V=-200$ mV, to 1.6 nm for $\Delta V=-300$, and to 0.9 nm for $\Delta V=-400$ mV.

The time $t_{\ell}$ for a pore’s radius to reach the critical radius $r_{c}$ is the time to lysis; it varies greatly and apparently randomly even within cells of a given kind. In erythrocytes, its mean value drops by nearly an order of magnitude with each increase of 100 mV in the transmembrane potential (Chernomordik et al., 1987) and is about a fifth of a second when $\Delta V=-300$ mV.

The chance of a potential $\Delta V$ forming a pore of radius $r$ is proportional to the Boltzmann factor $\exp(-E(r)/(kT))$. The higher the potential $\Delta V$ and the narrower the pore, the greater the chance of pore formation.

VI.2 The Model

In the model advanced in references (Cahill, 2009, 2010), a polyarginine sticks to the cell membrane as its guanidinium groups electrostatically interact with the phosphate groups of the outer leaflet of the phospholipid bilayer. If the positive charge of the polyarginine exceeds about $8|e|$, then it can raise the transmembrane potential above the threshold for electroporation, some $-200$ mV (Dai et al., 1997; Abidor et al., 1979; Chernomordik et al., 1987; Glaser et al., 1988; Weaver and Chizmadzhev, 1996; Melikov et al., 2001).

The transmembrane potential $\Delta V$ is the sum of three terms

$$\Delta V=\Delta V_{cell}+\Delta V_{CPP}+\Delta V_{NaCl}$$ (16)

the resting transmembrane potential $\Delta V_{cell}$ of the cell in the absence of CPPs, the transmembrane potential $\Delta V_{CPP}$ due to an oligoarginine or other CPP, and the transmembrane potential $\Delta V_{NaCl}$ due to the counterions of the extracellular medium. The resting transmembrane potential $\Delta V_{cell}$ of the cell varies between about 20 mV to more than 70 mV, depending upon the type of cell. Ideally, it is measured experimentally. The transmembrane potential $\Delta V_{CPP}$ due to an oligoarginine or to some other positively charged CPP may be determined from the formulas (1–8) for the potential of a charge outside a membrane (Cahill, 2010). The transmembrane potential $\Delta V_{NaCl}$ due to the counterions of the extracellular medium requires a Monte Carlo simulation of the Na⁺, Cl^-, and other ions of the extracellular medium in the electrostatic potential $V_{cell}+V_{CPP}$. This simulation was performed in (Cahill, 2010) with the aid of equations (1–8). The lipid bilayer insulates the extracellular counterions from the potential due to the counterions of the cytosol, however, so their potential may be neglected in the simulation of the extracellular counterions.

The values of $\Delta V_{CPP}+\Delta V_{NaCl}$ found in Monte Carlo simulations (Cahill, 2010) of the salt around an R^N oligoarginine are listed in the table. A resting transmembrane potential $-120<\Delta V_{cell}<-20$ mV should be added to these values of $\Delta V_{CPP}+\Delta V_{NaCl}$ to obtain the full transmembrane potential $\Delta V$. For $N>8$, the transmembrane potential $\Delta V$ can exceed $-200$ mV which is enough (Dai et al., 1997; Abidor et al., 1979; Chernomordik et al., 1987; Glaser et al., 1988; Weaver and Chizmadzhev, 1996; Melikov et al., 2001) to cause electroporation in common eukaryotic cells.

In references (Cahill, 2009) and (Cahill, 2010), it was pointed out that one way to test the model advanced in those papers would be to look for the formation of reversible pores by detecting transient (ms) changes in the conductance of membranes exposed to CPPs such as R⁹. Such experiments have now been done. Using the planar-phospholipid-bilayer method, Herce et al. found that R⁹ induced transient ionic currents through model phospholipid membranes (Herce et al., 2009). They estimated that the mean radius of these pores to be $0.66$ nm, which is safely below the limiting critical radius (15) of between 0.9 and 3.6 nm for the voltage range of $-400\leq\Delta V\leq-200$ mV. Moreover, using the patch-clamp technique, they found that R⁹ induced transient ionic currents through the membranes of both freshly isolated human umbilical-artery (HUA) smooth-muscle cells and cultured osteosarcoma cells (Herce et al., 2009). These experimental confirmations of the predictions made in references (Cahill, 2009) and (Cahill, 2010) lend some support to the model advanced in these papers and sketched in this subsection, but they do not prove that it is correct. It is, in any case, a continuum model of a molecular effect, and it may be consistent with the one simulated in reference (Herce et al., 2009).

VII Smart Drugs

Oligoarginines and other cell-penetrating peptides can carry cargos of up to 4000 Da across the lipid bilayer of eukaryotic cells by molecular electroporation (Cahill, 2009, 2010). This ability to transduce cargos that substantially exceed the nominal restriction barrier of 500 Da of the “rule of five” (Lipinski et al., 1997) makes possible therapies like those sketched in section III.

But we also need a way of targeting cancer cells. One way to do this has been suggested by Tsien (Jiang et al., 2004). His idea is to attach a negatively charged molecule, an anion, to the CPP-cargo molecule by a polypeptide linker that is cut primarily by peptidases that are over-expressed by the targeted cells. The geometry he proposed is

$$\mathsf{anion\!-\!linker\!-\!CPP\!-\!cargo}$$ (17)

in which the hyphens represent covalent bonds. The cargo is the therapeutic compound. It might be one of the peptides of ((Jiang et al., 2004)–(Tünnemann et al., 2007)), which consisted of between 8 and 33 amino acids, or simply a cytotoxin. If the negative charge of the anion lowers total charge of the anion-linker-CPP-cargo molecule below a few $|e|$, then it will not enter the cell by transduction because, in the model (Cahill, 2009, 2010), its transmembrane potential $\Delta V$ will be too small to cause electroporation. (The anion-linker-CPP-cargo molecule might enter the cell by endocytosis, but then it would risk destruction as the pH of the endosome dropped to that of a lysosome.) Metastatic cancer cells over-express certain transmembrane peptidases. So to target them, one would pick a linker that is cut by one of these over-expressed transmembrane peptidases.

VII.1 Better Geometries

One may improve the selectivity of such a smart drug by attaching two or more anions to the positively charged CPP-cargo by two or more different linkers that are cut primarily by different peptidases that are over-expressed by the targeted cells. A simple geometry for two anions and two different linkers is

$$\mathsf{anion_{1}\!-\!linker_{1}\!-\!CPP\!-\!cargo\!-\!linker_{2}\!-\!anion_{2}}.$$ (18)

To attach more than two anions by more than two different linkers, one can prepare an oxidizing solution of two classes of molecules. A simple example of a molecule of the first class is the molecule (18) with an extra cysteine (C)

$$\mathsf{anion_{1}\!-\!linker_{1}\!-\!C\!-\!CPP\!-\!cargo\!-\!linker_{2}\!-\!anion_{2}}$$ (19)

where the hyphens represent covalent bonds. Other examples of first-class molecules contain more cysteines to the left and/or right of the CPP-cargo moiety.

In a more compact notation in which A stands for an anion and L for a linker, two more examples of first-class molecules are

$$\mathsf{A_{1}\!-\!L_{1}\!-\!C\!-\!C\!-\!CPP\!-\!cargo\!-\!C\!-\!C\!-\!L_{2}\!-\!A_{2}}$$ (20)

with four extra cysteines and

$$\mathsf{A_{1}\!-\!L_{1}\!-\!C\!-\!C\!-\!C\!-\!CPP\!-\!cargo\!-\!C\!-\!C\!-\!C\!-\!L_{2}\!-\!A_{2}}$$ (21)

with six. First-class molecules must have their cysteines closer than any of the linkers to the CPP-cargo moiety; otherwise the cutting of a single linker could set adrift more than one anion.

Molecules of the second class consist of a cysteine covalently fused to a linker that in turn is covalently fused to an anion; that is, second-class molecules are of the form

$$\mathsf{C\!-\!L_{k}\!-\!A_{k}}$$ (22)

in which $\mathsf{L_{k}}$ is a linker cleavable by a peptidase over-expressed by the target cells and $\mathsf{A_{k}}$ is an anion.

In an oxidizing solution of these two classes of molecules, a cysteine of a second-class molecule can form a disulfide bond with a cysteine in a first-class molecule. Thus, smart drugs can form in which three or more anions are fused to the CPP-cargo molecule by linkers that can be cut by peptidases over-expressed by the target cells. For instance, an oxidizing solution of the first-class molecule (19) and the second-class molecule (22) would make the smart drug shown in Fig. 3. Similarly, an oxidizing solution of the first-class molecule (20) and the second-class molecule (22) for $k=3$, 4, 5, and 6 would form the smart drug of Fig. 4.

Of course, undesirable disulfide bonds also would form. One way to suppress unwanted disulfide bonds is to titrate a dilute reducing solution of different second-class molecules (22) into an oxidizing solution of first-class molecules such as (19, 20, or 21).

Figure 3: A smart drug consisting of a CPP-cargo molecule and three anions fused to it by three different linkers that are cut primarily by peptidases over-expressed mainly by the targeted cells. Here A, C, and L respectively stand for anion, cysteine, and (8 aa) linker. The hyphens and vertical lines represent covalent bonds.

Figure 4: A smart drug consisting of a CPP-cargo molecule and six anions fused to it by six different linkers that are cut primarily by peptidases over-expressed mainly by the targeted cells. A, C, L, hyphens, and vertical lines are as in Fig. 3.

The order of the linkers and anions does not matter as long as they are different and are cut primarily by peptidases that are over-expressed mainly by the target cells.

To achieve maximum specificity, it is desirable that the negative charge of each anion reduce the positive charge of the CPP to $4|e|$ or less, for in this case, the CPP-cargo molecule is not transduced until all the linkers are cleaved. Thus, if the CPP is the oligoarginine R⁹ with charge $9|e|$, then a smart drug like that in Fig. 4 would have six anions of charge $-5|e|$ for a total charge of $q=-21|e|$. Such smart drugs would be negatively charged.

By using well-chosen linkers, disulfide bonds, CPP’s, and cell-penetrating molecules (CPM’s) such as cationic lipids, one can make a very wide variety of smart drugs.

VII.2 Linkers

Linkers are essential to the selectivity of the smart drugs sketched in this section. Each linker must be a short peptide that is cut primarily by a peptidase that is over-expressed mainly by the targeted cells.

MT1-MMP is a type-1 transmembrane proteinase essential for skeletal development, metastasis, and angiogenesis. The Burnham Institute’s cut database Burnham lists 37 eight-aa-long sequences that have been shown by experiment to be cut by MT1-MMP and that are not known to be cut by other human peptidases: psqg-qkve, npmg-sepv, gyfg-dpla, nlag-ilke, glrg-lqgp, lrrl-lglf, aveg-sgks, dlsl-ispl, lisp-laqa, geyr-tnpe, psqg-qkve, tkrd-lals, rvlg-lete, rllg-lfge, dpfr-lqct, lppg-lplt, ppsy-lgdr, qlyg-gesg, nffp-rkpk, dpsa-imap, qglk-wqhn, fciq-nytp, aepw-tvrn, qqly-gges, pqpr-ttsr, aqlg-vmqg, mdet-mkel, kayk-sele, llil-sdvn, lils-dvnd, dshs-lttn, lrgd-fssa, nmid-aatl, kaiq-ltyn, glrg-lqgp, sser-ssts, and tsgg-yify. MT1-MMP cuts these 37 octapeptides at the hyphens. Although 37 sequences may seem so numerous as to be unselective, in fact, they are 37 out of $20^{8}=25,600,000,000$ possible 8-aa sequences.

The ADAMs are membrane proteins that have both a disintegrin domain and a metalloprotease domain. ADAM9, 10, 12, 15, and 17 have been found in cancer cells. ADAM17 (aka tace) sheds and/or processes tnf$\alpha$, tgf$\alpha$, app, amphiregulin, p75tnfr, p55tnfr, trance, L-selectin, IL-6 receptor, IL-1 receptor II, Notch1 receptor, growth hormone-binding protein, muc1, and transmembrane collagen XVII Duffy et al. (2003). The Burnham cut database Burnham lists nine eight-amino-acid-long sequences that have been shown by experiment to be cut by adam17 and that are not known to be cut by any other human peptidase: dlla-vvaa, nsar-segp, kldk-sfsm, lpvq-dsss, wtgh-stlp, rlrr-glaa, ksmk-thsm, rveq-vvkp, and vaaa-vvsh. The cuts occur at the hyphens.

Prostate-specific membrane antigen (PSMA) is a glutamate carboxypeptidase II highly expressed by prostate epithelial cells and by the neovasculature of many tumor types but not by endothelial cells in normal tissue Mhaka et al. (2004). Denmeade et al.  have found Mhaka et al. (2004) that the substrate

$$\mathsf{APA\!-\!D\!-\!E}^{*}\mathsf{E}^{*}\mathsf{D\!-\!E}$$ (23)

is stable in blood but is cut—at the second hyphen— by PSMA. Here APA is 4-n[n-2,4diamino-6-pteridinyl-methyl)-n-methylamino-benzoate], and the asterisks represent $\gamma$-linkages, while the hyphens stand for the usual $\alpha$-linkages.

VII.3 Cell-Penetrating Molecules

Figure 5: A smart drug consisting of a CPP-cargo molecule and four anions fused to it by four different linkers that are cut primarily by peptidases over-expressed mainly by the targeted cells. P_i stands for inorganic phosphate, FA for fatty acid, and Gl for glycerol. A, C, L, hyphens, and vertical lines are as in Fig. 3.

Two features of oligoarginines allow them to penetrate through cell membranes: a positive charge exceeding $8|e|$ and several guanidinium groups. Thus any molecule with several guanidinium groups and a positive charge exceeding $8|e|$ may be as good a cell-penetrating molecule (CPM) as the oligoarginines considered in this paper.

Cationic lipids can penetrate cell membranes; they form another category of cell-penetrating molecules. One design for a cationic lipid has one or several serines S and/or threonines T to the left and/or right of the CPP-cargo moiety. Thus an example of a first-class molecule for a cationic-lipid CPM is

$$\mathsf{A_{1}\!-\!L_{1}\!-\!S\!-\!C\!-\!CPP\!-\!cargo\!-\!C\!-\!T\!-\!L_{2}\!-\!A_{2}}.$$ (24)

To complete this first-class molecule one would use the same kind (22) of second-class molecule and third-class molecules that are either a fatty acid FA fused to an inorganic phosphate group $\mathsf{P_{i}}$ by an acyl-phosphate bond

$$\mathsf{FA}\!-\!\mathsf{P_{i}}$$ (25)

or a phospholipid without its polar head group

$$(\mathsf{FA})^{2}\!=\!\mathsf{Gl}\!-\!\mathsf{P_{i}}$$ (26)

in which Gl is a glycerol. One would make the cationic-lipid CPM by fusing the second-class molecules to the cysteines C by disulfide bonds and the third-class molecules to the hydroxyl groups of serines S and threonines T by ester bonds. The resulting smart drug is illustrated in Fig. 5. Such cationic-lipid smart drugs with various numbers of anions, linkers, and lipids may be able to carry therapeutic cargos across the cell membrane.

VII.4 Stability

Blood has peptidases that cut peptides and RNAses that cut RNAs, but there are some biochemical tricks that can increase the stability of peptides and RNAs in smart drugs. One may use right-handed amino acids to frustrate peptidases. A peptide made of right-handed amino acids in reverse order can have similar biochemical properties to its normally ordered left-handed twin (Chorev and Goodman, 1993). Such retro-inverso peptides are more stable in the body and were used in several of the therapeutic experiments sketched in section III. RNAs made with 2’-O-methyl-modified nucleotides with phosphorothioate linkages resist RNAses (Krutzfeldt1 et al., 2005). The wide class of cell-penetrating molecules may have members that are stable in the human body and unlikely to stimulate an immune response.

VII.5 Ligands and Antibodies

What is really needed for specificity is knowledge of what distinguishes the surface of a cancer cell from that of a healthy cell. Cancer cells over-express many receptors, such as the CXC chemokine receptor 4 (CXCR4), the specific neurokinin-1 (NK-1) receptor, folate receptors (FRs), the G-protein-coupled protease-activated receptor PAR-1, and receptors for many regulatory peptides. Metastatic cancer cells over-express many transmembrane peptidases. A reasonably complete characterization of the distinguishing features of the surfaces of cancer cells would advance the development of compounds that bind to these features. Such an artificial feature-ligand (FL) could guide a CPP-cargo molecule to cancer cells. The simplest geometry would be

$$\mathsf{FL\!-\!L_{1}\!-\!CPP\!-\!cargo\!-\!L_{2}\!-\!A}$$ (27)

in which the linkers $L_{1}$ and $L_{2}$ are cleavable by peptidases overexpressed by the cancer cell that overexpresses the feature $F$.

VIII Summary

In a model, which recently has received some experimental support, polyarginines carry cargos by molecular electroporation across the cell membrane. They and other cell-penetrating peptides (CPPs) as well as cell-penetrating molecules (CPMs), such as cationic lipids, can transduce therapeutic cargos that greatly exceed the 500 Da restriction barrier. They may solve part of the drug-delivery problem.

The use of well chosen linkers and anions can help target cancer cells and spare healthy ones. The development of really smart drugs, however, requires a more complete characterization of the differences between the surfaces of cancer cells and those of normal cells.