Singular loci of Schubert varieties and the Lookup Conjecture in type A~2fragments~𝐴2\widetilde{A}_{2}

Brian D. Boe Department of Mathematics, University of Georgia, Athens, GA 30602 brian@math.uga.edu  and  William Graham Department of Mathematics, University of Georgia, Athens, GA 30602 wag@uga.edu
Abstract.

We describe the loci of non-rationally smooth (nrs) points and of singular points for any non-spiral Schubert variety of A~2fragments~𝐴2\widetilde{A}_{2} in terms of the geometry of the (affine) Weyl group action on the plane 2fragmentsR2\mathbb{R}^{2}. Together with the results of Graham and Li for spiral elements, this allows us to explicitly identify the maximal singular and nrs points in any Schubert variety of type A~2fragments~𝐴2\widetilde{A}_{2}. Comparable results are not known for any other infinite-dimensional Kac-Moody flag variety (except for type A~1fragments~𝐴1\widetilde{A}_{1}, where every Schubert variety is rationally smooth). As a consequence, we deduce that if x𝑥x is a point in a non-spiral Schubert variety XwfragmentsX𝑤X_{w}, then x𝑥x is nrs in XwfragmentsX𝑤X_{w} if and only if there are more than dimXwfragmentsdimensionX𝑤\dim X_{w} curves in XwfragmentsX𝑤X_{w} through x𝑥x which are stable under the action of a maximal torus, as is true for Schubert varieties in (finite) type A𝐴A. Combined with the work of Graham and Li for spiral Schubert varieties, this implies the Lookup Conjecture for A~2fragments~𝐴2\widetilde{A}_{2}.

1. Introduction

The local topology of Schubert varieties at torus-fixed points has been of interest since the foundational paper [KaLu:79] of Kazhdan and Lusztig connecting this topology with representation theory. The connection is simplest when the fixed point is rationally smooth, which holds automatically if the point is smooth, and there has been considerable interest in understanding the loci of smooth and rationally smooth points in Schubert varieties (see e.g. [BiLa:00]). For example, the loci of non-smooth (i.e. singular) and non-rationally smooth (nrs) points are closed, and identifying the torus-fixed points in these loci which are maximal (in terms of the Bruhat order) would make it relatively easy to test whether any fixed point is smooth or rationally smooth.

In this paper, we study the loci of rationally smooth points and of smooth points in Schubert varieties in the flag variety for the Kac-Moody group of type A~2fragments~𝐴2\widetilde{A}_{2}. We give explicit descriptions of these loci in terms of the action of the (affine) Weyl group W𝑊W on the plane 2fragmentsR2\mathbb{R}^{2}. In particular, the results of this paper, combined with the results of [GrLi:21] and [GrLi:15] for spiral elements, allow us identify the maximal singular and nrs points in any Schubert variety of type A~2fragments~𝐴2\widetilde{A}_{2}. This provides a computationally efficient way to test whether any torus-fixed point is smooth or rationally smooth. Comparable results are not known for any other infinite-dimensional Kac-Moody flag variety (except for type A~1fragments~𝐴1\widetilde{A}_{1}, where every Schubert variety is rationally smooth [BiCr:12]). By studying type A~2fragments~𝐴2\widetilde{A}_{2} in detail, we obtain insight which should be helpful in studying other Kac-Moody flag varieties.

Our methods allow us to complete the proof of the Lookup Conjecture (see [BoGr:03]) for type A~2fragments~𝐴2\widetilde{A}_{2}. In particular, we prove that if x𝑥x is a point in a non-spiral111Here the spiral elements are as defined in [GrLi:21]. As discussed in that paper, the term spiral was adopted from [BiMi:10], but the definitions of [GrLi:21] and [BiMi:10] differ slightly. Schubert variety XwfragmentsX𝑤X_{w}, then x𝑥x is nrs in XwfragmentsX𝑤X_{w} if and only if there are more than dimXwfragmentsdimensionX𝑤\dim X_{w} curves in XwfragmentsX𝑤X_{w} through x𝑥x which are stable under the action of a maximal torus, as is true for Schubert varieties in (finite) type A𝐴A. In other words, for non-spiral Schubert varieties of type A~2fragments~𝐴2\widetilde{A}_{2}, only the trivial case of the Lookup Conjecture (see [BoGr:03]) occurs. For spiral Schubert varieties, the Lookup Conjecture was verified in [GrLi:21]. We conclude that the Lookup Conjecture is true in type A~2fragments~𝐴2\widetilde{A}_{2}.

Since we can identify the loci of singular and nrs points in any Schubert variety in type A~2fragments~𝐴2\widetilde{A}_{2}, we can identify the Schubert varieties for which these loci are empty – that is, the Schubert varieties which are rationally smooth or smooth. These Schubert varieties had previously been identified by Billey and Crites [BiCr:12] in the case of A~2fragments~𝐴2\widetilde{A}_{2}, in somewhat different terms. See Corollaries 7.1 and LABEL:c:smoothSchubertvar and Remark LABEL:r:BilleyCrites.

It is well-known that the singular locus of a Schubert variety has codimension at least 2 (in other words, Schubert varieties are non-singular in codimension 1). We prove a converse to this result in type A~2fragments~𝐴2\widetilde{A}_{2}: if XwfragmentsX𝑤X_{w} is not one of the 31 smooth Schubert varieties or 33 singular Schubert varieties of small dimension, then the singular locus of XwfragmentsX𝑤X_{w} has codimension exactly 2. Moreover, any Schubert subvariety of codimension at least 6 is contained in the singular locus. If XwfragmentsX𝑤X_{w} is not a rationally smooth Schubert variety, then the nrs locus of XwfragmentsX𝑤X_{w} has codimension at most 444. More precise statements are given in Sections 8 and LABEL:s:smooth. The smooth points of a non-spiral Schubert variety of type A~2fragments~𝐴2\widetilde{A}_{2} are identified in Theorem LABEL:t:smoothLocus. We see that a “generic” Schubert variety has exactly 363636 smooth torus-fixed smooth points; for non-generic Schubert varieties, this number can be smaller.

We now describe our results in more detail. Let 𝒢𝒢\mathcal{G} be a Kac-Moody group and \mathcal{B} a standard Borel subgroup, with TfragmentsTBT\subset\mathcal{B} a maximal torus. Let W𝑊W denote the corresponding Weyl group. The flag variety X=𝒢/fragmentsXGBX=\mathcal{G}/\mathcal{B} is not necessarily finite dimensional, but it can be written as a union of finite dimensional algebraic varieties. Corresponding to each wWfragmentswWw\in W there is a subset X0w=wfragmentsX0𝑤BwBX^{0}_{w}=\mathcal{B}w\mathcal{B} of X𝑋X, whose closure is the Schubert variety XwfragmentsX𝑤X_{w}. This is a finite dimensional algebraic variety whose dimension (over \mathbb{C}) is the length (w)fragments(w)\ell(w) of w𝑤w. The point xfragmentsxBx\mathcal{B} is in XwfragmentsX𝑤X_{w} if and only if xwfragmentsxwx\leq w with respect to the Bruhat order on W𝑊W. The variety XwfragmentsX𝑤X_{w} is the (finite) union of all Xx0fragmentsX𝑥0X_{x}^{0} for xwfragmentsxwx\leq w . The local topology of XwfragmentsX𝑤X_{w} is the same at any point of a given Xx0fragmentsX𝑥0X_{x}^{0}, so to determine the loci of smooth or rationally smooth points in XwfragmentsX𝑤X_{w}, it suffices to determine which T𝑇T-fixed points xfragmentsxBx\mathcal{B} are smooth or rationally smooth.

Non-rational smoothness can be detected by the following criterion, due to Carrell and Peterson, which is equivalent to a condition that had happeared in Jantzen’s work on highest weight modules ([Car:94], [Jan:79]; see [Kum:02, Theorem 12.2.14]). Given xwfragmentsxwx\leq w, let nwxfragmentsn𝑤𝑥n^{w}_{x} denote the number of reflections r𝑟r in W𝑊W such that rxwfragmentsrxwrx\leq w, and let qwx=nwx(w)fragmentsq𝑤𝑥n𝑤𝑥(w)q^{w}_{x}=n^{w}_{x}-\ell(w). The numbers qwxfragmentsq𝑤𝑥q^{w}_{x} are all non-negative. The point xfragmentsxBx\mathcal{B} is nrs in XwfragmentsX𝑤X_{w} if and only if qwy>0fragmentsq𝑤𝑦0q^{w}_{y}>0 for some yWfragmentsyWy\in W with xywfragmentsxywx\leq y\leq w.

Given w𝑤w in W𝑊W, we say that the Lookup Conjecture holds for w𝑤w (or for XwfragmentsX𝑤X_{w}), if, for all xwfragmentsxwx\leq w, xfragmentsxBx\mathcal{B} is nrs in XwfragmentsX𝑤X_{w} if and only if qwy>0fragmentsq𝑤𝑦0q^{w}_{y}>0 for y=xfragmentsyxy=x or for some x<y=rxwfragmentsxyrxwx<y=rx\leq w, where r𝑟r is a reflection in W𝑊W. The Lookup Conjecture states that the Lookup Conjecture holds for all wWfragmentswWw\in W. If true, the Lookup Conjecture would greatly reduce the number of qwyfragmentsq𝑤𝑦q^{w}_{y} that need to be computed to detect non-rational smoothness.

The nontrivial case of the Lookup Conjecture occurs when xfragmentsxBx\mathcal{B} is nrs in XwfragmentsX𝑤X_{w} and qwx=0fragmentsq𝑤𝑥0q^{w}_{x}=0. The trivial case occurs when xfragmentsxBx\mathcal{B} is nrs in XwfragmentsX𝑤X_{w} and qwx>0fragmentsq𝑤𝑥0q^{w}_{x}>0. The statement that only the trivial case of the Lookup Conjecture holds for w𝑤w means that xfragmentsxBx\mathcal{B} is nrs in XwfragmentsX𝑤X_{w} if and only if qwx>0fragmentsq𝑤𝑥0q^{w}_{x}>0. If this holds, the Lookup Conjecture holds for w𝑤w. In (finite) type AnfragmentsA𝑛A_{n}, only the trivial case of the Lookup Conjecture occurs for any wWfragmentswWw\in W (see [Deo:85]), and so the Lookup Conjecture is true in type AnfragmentsA𝑛A_{n}.

In type A~2fragments~𝐴2\widetilde{A}_{2}, Graham and Li [GrLi:21] proved that the Lookup Conjecture holds (nontrivially) for so-called spiral elements wWfragmentswWw\in W: those which have a reduced expression sisjsksisjsksifragmentss𝑖s𝑗s𝑘s𝑖s𝑗s𝑘s𝑖s_{i}s_{j}s_{k}s_{i}s_{j}s_{k}s_{i}\dots, where i,j,kfragmentsi,j,ki,j,k are distinct. To prove the Lookup Conjecture in type A~2fragments~𝐴2\widetilde{A}_{2}, it therefore suffices to prove that if w𝑤w is not spiral, then xfragmentsxBx\mathcal{B} is nrs in XwfragmentsX𝑤X_{w} if and only if qwx>0fragmentsq𝑤𝑥0q^{w}_{x}>0, as had been observed by Graham and Li in examples. One of our main results is that this is true, and therefore the Lookup Conjecture holds in type A~2fragments~𝐴2\widetilde{A}_{2}.

As in [GrLi:21], we make use of the action of W𝑊W on a Euclidean space V2fragmentsVR2V\cong\mathbb{R}^{2}. Let ΦΦ\Phi denote the finite root system of type A2fragmentsA2A_{2}, so ΦΦ\Phi consists of the roots α1,α2,α~=α1+α2fragmentsα1,α2,~𝛼α1α2\alpha_{1},\alpha_{2},\widetilde{\alpha}=\alpha_{1}+\alpha_{2}, and their negatives. Corresponding to each αΦfragmentsαΦ\alpha\in\Phi and each kfragmentskZk\in\mathbb{Z}, there is an affine root hyperplane (in fact, a line) Hα,kfragmentsHfragmentsα,kH_{\alpha,k} in V𝑉V, consisting of the vVfragmentsvVv\in V whose inner product with α𝛼\alpha is k𝑘k. The Weyl group W𝑊W is the group of (affine) transformations of V𝑉V generated by the (affine) reflections sα,kfragmentssfragmentsα,ks_{\alpha,k} in the Hα,kfragmentsHfragmentsα,kH_{\alpha,k}. The connected components of the complement of the union of the root hyperplanes are called alcoves.

We fix an alcove A0fragmentsA0A_{0}, which we call the fundamental alcove, and let q𝑞q denote the center of A0fragmentsA0A_{0}. The group W𝑊W acts simply transitively on the set of alcoves, or equivalently, on the set of alcove centers, so we have bijections

W{alcoves}{alcove centers}fragmentsW{alcoves}{alcove centers}W\leftrightarrow\{\mbox{alcoves}\}\leftrightarrow\{\mbox{alcove centers}\}
wwA0wq.fragmentswwA0wq.w\leftrightarrow wA_{0}\leftrightarrow wq.

The spiral elements correspond to the alcoves lying in regions we call fundamental root strips. The complement of the union of these strips has 6 components, which we call chambers. Unlike Weyl chambers, these are not all equivalent; rather, they are of two types, which we call even and odd. The details are in Section 2.

Our results rely on a description of the Bruhat order in terms of alcove geometry. We identify Weyl group elements with alcove centers, as above. Given a non-spiral element wWfragmentswWw\in W, we show that the set of xWfragmentsxWx\in W such that xwfragmentsxwx\leq w coincides with the set wfragmentsH𝑤\mathcal{H}_{w} of elements lying in a convex hexagon, which we define explicitly by specifying its vertices (see Theorem 4.1). Our methods can be used to recover the analogous result for spiral elements from [GrLi:21], with a simpler proof. The hexagon is not regular, but it has greater symmetry if w𝑤w lies in an even chamber. As a consequence, many of our results have simpler statements for such w𝑤w than for w𝑤w in an odd chamber. After proving Theorem 4.1, we learned that this result, as well as the analogous result for spiral elements, were conjectured in [Jit:23]. That paper also contains an outline of a proof of the conjecture, which makes use of ideas similar to some ideas in our proof of Theorem 4.1.

Using the Bruhat hexagon wfragmentsH𝑤\mathcal{H}_{w}, we describe the set of x𝑥x such that qwx>0fragmentsq𝑤𝑥0q^{w}_{x}>0, and deduce that if xywfragmentsxywx\leq y\leq w and qwy>0fragmentsq𝑤𝑦0q^{w}_{y}>0, then qwx>0fragmentsq𝑤𝑥0q^{w}_{x}>0. This implies that xfragmentsxBx\mathcal{B} is nrs in XwfragmentsX𝑤X_{w} if and only if qwx>0fragmentsq𝑤𝑥0q^{w}_{x}>0. The proofs are inductive. They make use of the relationship between wfragmentsH𝑤\mathcal{H}_{w} and wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}}, where wfragmentsww^{\prime} is obtained from w𝑤w by a simple reflection or by “translation into the chamber.” In fact, we obtain a fairly explicit description of qwxfragmentsq𝑤𝑥q^{w}_{x} in terms of the location of x𝑥x in wfragmentsH𝑤\mathcal{H}_{w}. We identify the maximal nrs points of XwfragmentsX𝑤X_{w}, and deduce that if XwfragmentsX𝑤X_{w} is nrs, then the codimension of the nrs locus is either 3 or 4.

Not all the rationally smooth points in XwfragmentsX𝑤X_{w} are smooth. To determine the smooth locus, as in [GrLi:15], we use Kumar’s criterion in terms of equivariant multiplicities ewxfragmentse𝑤𝑥e^{w}_{x}. These geometric invariants contain more information than the integers qwxfragmentsq𝑤𝑥q^{w}_{x}, but they are considerably more difficult to calculate. However, knowing the nrs locus in XwfragmentsX𝑤X_{w} allows us to determine the smooth locus by calculating ewxfragmentse𝑤𝑥e^{w}_{x} for a small number of x𝑥x for which (w)(x)3fragments(w)(x)3\ell(w)-\ell(x)\leq 3. This computation turns out to be manageable. We describe the smooth locus of a non-spiral XwfragmentsX𝑤X_{w} by identifying six elements of wfragmentsH𝑤\mathcal{H}_{w} near each vertex of the hexagon, such that xfragmentsxBx\mathcal{B} is a smooth point of XwfragmentsX𝑤X_{w} if and only if x𝑥x is one of these elements. As a consequence, we see that any Schubert variety of type A~2fragments~𝐴2\widetilde{A}_{2} has at most 36 smooth torus-fixed points. We identify the maximal singular points, and conclude that except for finitely many Schubert varieties of dimension at most 9, the singular locus of XwfragmentsX𝑤X_{w} has codimension 2. Moreover, any Schubert subvariety of XwfragmentsX𝑤X_{w} of codimension 7 or more is contained in the singular locus.

2. Affine Weyl groups and Schubert varieties

In this section we summarize some facts about affine Weyl groups and Schubert varieties for Kac-Moody groups, and prove an extension of the Setup Move of [BoGr:03] to equivariant multiplicities. Our main references are [Hum:90], [BjBr:05], [Kum:02], and [BoGr:03]; some of the exposition is from [GrLi:21].

2.1. Affine Weyl groups

Let V𝑉V be a Euclidean space; that is, a real vector space equipped with a positive definite inner product (,)fragments(,)(\cdot,\cdot). We will use the inner product to identify V𝑉V with VfragmentsVV^{*}, and view both roots and coroots as elements of V𝑉V. Let ΦVfragmentsΦV\Phi\subset V be an irreducible root system, and ΦVfragmentsΦV\Phi^{\vee}\subset V the dual root system; the coroot αfragmentsα\alpha^{\vee} is related to the root α𝛼\alpha by α=2α/(α,α)fragmentsα2α(α,α)\alpha^{\vee}=2\alpha/(\alpha,\alpha). If there is only one root length, we scale the inner product so that (α,α)=2fragments(α,α)2(\alpha,\alpha)=2 for each root, and then Φ=ΦfragmentsΦΦ\Phi=\Phi^{\vee}. Let L(Φ)VfragmentsL(Φ)VL(\Phi^{\vee})\subset V denote the abelian group generated by ΦfragmentsΦ\Phi^{\vee}. We will identify L(Φ)fragmentsL(Φ)L(\Phi^{\vee}) with the corresponding group of translations of V𝑉V; the translation corresponding to γL(Φ)fragmentsγL(Φ)\gamma\in L(\Phi^{\vee}) is denoted by t(γ)fragmentst(γ)t(\gamma).

Given αΦfragmentsαΦ\alpha\in\Phi and kfragmentskZk\in\mathbb{Z}, let Hα,k={vV(α,v)=k}fragmentsHfragmentsα,k{vV(α,v)k}H_{\alpha,k}=\{v\in V\mid(\alpha,v)=k\}, called a root hyperplane. Let sα,k:VVfragmentssfragmentsα,k:VVs_{\alpha,k}:V\to V denote the map given by reflection across this hyperplane; we write sα=sα,0fragmentss𝛼sfragmentsα,0s_{\alpha}=s_{\alpha,0}, and then sα,k=t(kα)sαfragmentssfragmentsα,kt(kα)s𝛼s_{\alpha,k}=t(k\alpha^{\vee})s_{\alpha}. The affine Weyl group W𝑊W associated to ΦΦ\Phi is the group of affine transformations of V𝑉V generated by the elements sα,kfragmentssfragmentsα,ks_{\alpha,k}, and the finite Weyl group WffragmentsW𝑓W_{f} is the subgroup of W𝑊W generated by the sαfragmentss𝛼s_{\alpha}. The group WffragmentsW𝑓W_{f} acts on L(Φ)fragmentsL(Φ)L(\Phi^{\vee}) by wt(γ)=t(w(γ))fragmentswt(γ)t(w(γ))w\cdot t(\gamma)=t(w(\gamma)), and W𝑊W can be identified with the semidirect product L(Φ)WffragmentsL(Φ)right-normal-factor-semidirect-productW𝑓L(\Phi^{\vee})\rtimes W_{f}. We have the following useful formulas:

wsβw1=swβandt(λ)sβ,kt(λ)=sβ,k+(λ,β)fragmentsws𝛽wfragments1sfragmentswβandt(λ)sfragmentsβ,kt(λ)sfragmentsβ,k(λ,β)ws_{\beta}w^{-1}=s_{w\beta}\quad\text{and}\quad t(\lambda)s_{\beta,k}t(-\lambda)=s_{\beta,k+(\lambda,\beta)} (2.1)

for βΦfragmentsβΦ\beta\in\Phi, wWffragmentswW𝑓w\in W_{f}, kfragmentskZk\in\mathbb{Z}, and λVfragmentsλV\lambda\in V satisfying (λ,α)fragments(λ,α)Z(\lambda,\alpha)\in\mathbb{Z} for all αΦfragmentsαΦ\alpha\in\Phi (see [Hum:90, Prop. 4.1]). We will later use the corollary that if (β,λ)=kfragments(β,λ)k(\beta,\lambda)=k, then

sβ,kt(λ)=t(λ)sβ.fragmentssfragmentsβ,kt(λ)t(λ)s𝛽.s_{\beta,k}t(\lambda)=t(\lambda)s_{\beta}. (2.2)

Choose a set of simple roots {α1,,αn}fragments{α1,,α𝑛}\{\alpha_{1},\ldots,\alpha_{n}\} for ΦΦ\Phi, and write si=sαifragmentss𝑖sfragmentsα𝑖s_{i}=s_{\alpha_{i}}. Let α~~𝛼\widetilde{\alpha} denote the highest root and let s0=sα~,1fragmentss0sfragments~𝛼,1s_{0}=s_{\widetilde{\alpha},1}. The elements s0,s1,,snfragmentss0,s1,,s𝑛s_{0},s_{1},\ldots,s_{n} are called simple reflections, and they generate W𝑊W (even as a Coxeter group). The length (w)fragments(w)\ell(w) of an element wWfragmentswWw\in W is equal to \ell if w𝑤w can be written as a product of \ell simple reflections, but no fewer. Given x,yWfragmentsx,yWx,y\in W, let H(x,y)fragmentsH(x,y)H(x,y) denote the set of hyperplanes Hα,kfragmentsHfragmentsα,kH_{\alpha,k} separating xA0fragmentsxA0xA_{0} and yA0fragmentsyA0yA_{0}, for αΦfragmentsαΦ\alpha\in\Phi and kfragmentskZk\in\mathbb{Z}. Then (w)=|H(w,e)|fragments(w)|H(w,e)|\ell(w)=|H(w,e)|, where e𝑒e denotes the identity element of W𝑊W [Hum:90, Theorem 4.5].

The reflections in W𝑊W are defined to be the conjugates in W𝑊W of the sifragmentss𝑖s_{i}; if there is only one root length, then the reflections are exactly the elements sα,kfragmentssfragmentsα,ks_{\alpha,k} for αΦfragmentsαΦ\alpha\in\Phi and kfragmentskZk\in\mathbb{Z} (see for example [GrLi:21, Section 2]). Let R𝑅R denote the set of reflections in W𝑊W. The Bruhat order on W𝑊W is the partial order generated by the relations w<rwfragmentswrww<rw where rRfragmentsrRr\in R and (w)<(rw)fragments(w)(rw)\ell(w)<\ell(rw).

Given wWfragmentswWw\in W, let R(w)fragmentsR(w)R(w) (resp. L(w)fragmentsL(w)L(w)) denote the subgroup of W𝑊W generated by the simple reflections s𝑠s such that ws<wfragmentswswws<w (resp. sw<wfragmentsswwsw<w). The group R(w)fragmentsR(w)R(w) (resp. L(w)fragmentsL(w)L(w)) is isomorphic to the finite Weyl group corresponding to the Coxeter graph obtained from the Coxeter graph of W𝑊W by deleting the simple reflections not in R(w)fragmentsR(w)R(w) (resp. L(w)fragmentsL(w)L(w)). If w𝑤w is not the identity element e𝑒e, then R(w)fragmentsR(w)R(w) contains at least one simple reflection. If ΦΦ\Phi is of type A2fragmentsA2A_{2}, then R(w)fragmentsR(w)R(w) contains exactly one simple reflection s𝑠s, in which case it is the group {e,s}fragments{e,s}\{e,s\}, or R(w)fragmentsR(w)R(w) contains two simple reflections s,tfragmentss,ts,t, in which case it is isomorphic to the Weyl group of type A2fragmentsA2A_{2} generated by s𝑠s and t𝑡t.

The alcoves are the connected components of VαΦ,kHα,kfragmentsVfragmentsαΦ,kZHfragmentsα,kV\,\setminus\,\bigcup_{\alpha\in\Phi,k\in\mathbb{Z}}\ H_{\alpha,k}. The alcove bounded by the hyperplanes Hα1,0,,Hαn,0,Hα~,1fragmentsHfragmentsα1,0,,Hfragmentsα𝑛,0,Hfragments~𝛼,1H_{\alpha_{1},0},\dots,H_{\alpha_{n},0},H_{\widetilde{\alpha},1} is called the fundamental alcove, and denoted AfragmentsAA_{\circ}. Thus A={vV(v,αi)>0,i=1,,n, and (v,α~)<1}fragmentsA{vV(v,α𝑖)0,i1,,n, and (v,~𝛼)1}A_{\circ}=\{v\in V\mid(v,\alpha_{i})>0,i=1,\ldots,n,\mbox{ and }(v,\widetilde{\alpha})<1\}. Let q𝑞q denote the center of the alcove AfragmentsAA_{\circ}, so wqfragmentswqwq is the center of the alcove wAfragmentswAwA_{\circ}, wWfragmentswWw\in W. The Weyl group W𝑊W acts simply transitively on the set of alcoves, so there are bijections W{alcoves}WqfragmentsW{alcoves}WqW\leftrightarrow\{\mbox{alcoves}\}\leftrightarrow Wq given by wwAwqfragmentswwAwqw\leftrightarrow wA_{\circ}\leftrightarrow wq. Using these bijections, we will frequently identify elements of W𝑊W with alcoves and alcove centers.

2.2. Schubert varieties

Associated to the root system ΦΦ\Phi there is a Kac-Moody group 𝒢𝒢\mathcal{G} of affine type (over the ground field \mathbb{C}) with Borel subgroup \mathcal{B}, whose Weyl group is the affine Weyl group W𝑊W associated to ΦΦ\Phi. The flag variety is X=𝒢/fragmentsXGBX=\mathcal{G}/\mathcal{B}, which has the structure of a projective ind-variety. Given wWfragmentswWw\in W, the Schubert variety XwfragmentsX𝑤X_{w} is defined as the union xwx/XfragmentsfragmentsxwBxBBX\cup_{x\leq w}\mathcal{B}x\mathcal{B}/\mathcal{B}\subset X; it is the closure of the \mathcal{B}-orbit Xw0=wfragmentsX𝑤0BwBX_{w}^{0}=\mathcal{B}\cdot w\mathcal{B}, and has the structure of a finite dimensional projective variety of dimension (w)fragments(w)\ell(w). We will be concerned with the loci of smooth and rationally smooth points in XwfragmentsX𝑤X_{w}. Rational smoothness is a topological condition related to smoothness, but weaker: a smooth point is rationally smooth, but the converse can fail. For the definition of rational smoothness, see for example [Kum:02, Definition 12.2.7]. We will not need this definition; our main tools for determining rational smoothness and smoothness will be (respectively) the Carrell-Peterson criterion described in the introduction, and Kumar’s smoothness criterion [Kum:02, Theorems 12.2.14, 12.1.11]. For brevity, we write nrs to mean not rationally smooth.

We have xXwfragmentsxBX𝑤x\mathcal{B}\in X_{w} \Leftrightarrow XxXwfragmentsX𝑥X𝑤X_{x}\subseteq X_{w} \Leftrightarrow xwfragmentsxwx\leq w. The singular locus and nrs locus in XwfragmentsX𝑤X_{w} are closed and \mathcal{B}-invariant, so they are unions of Schubert varieties; moreover, XxfragmentsX𝑥X_{x} is in the singular or nrs locus of XwfragmentsX𝑤X_{w} if and only if the point xfragmentsxBx\mathcal{B} is. Hence, if xywfragmentsxywx\leq y\leq w and the point yfragmentsyBy\mathcal{B} is singular (resp. nrs) in XwfragmentsX𝑤X_{w}, then so xfragmentsxBx\mathcal{B}. Hence, to determine the loci of singular or nrs points in XwfragmentsX𝑤X_{w}, it suffices to determine which points xfragmentsxBx\mathcal{B} are singular or nrs in XwfragmentsX𝑤X_{w}. The singular locus of any Schubert variety XwfragmentsX𝑤X_{w} has codimension at least 222 [Kum:02, Prop. 12.1.1], so wfragmentswBw\mathcal{B} is smooth in XwfragmentsX𝑤X_{w}, and if x<wfragmentsxwx<w and (x)=(w)1fragments(x)(w)1\ell(x)=\ell(w)-1, then xfragmentsxBx\mathcal{B} is smooth in XwfragmentsX𝑤X_{w}.

If xwfragmentsxwx\leq w and uR(w)fragmentsuR(w)u\in R(w), there is a close relationship between invariants of XwfragmentsX𝑤X_{w} at the points xfragmentsxBx\mathcal{B} and xufragmentsxuBxu\mathcal{B}, for example, the values of the integers qwfragmentsq𝑤q^{w}_{\bullet}, rational smoothness, and smoothness. There are analogous relationships for uL(w)fragmentsuL(w)u\in L(w). We use the term “Simple Move” (adapted from [BoGr:03]) to refer to such a relationship.

The next proposition states some of the simple move relationships for uR(w)fragmentsuR(w)u\in R(w). The proposition is an extension of results from [BoGr:03, Section 4]; see also [GrLi:21] and [GrLi:15]. There is an analogous version for uL(w)fragmentsuL(w)u\in L(w), which we will also use.

Proposition 2.1.

Let wWfragmentswWw\in W and uR(w)fragmentsuR(w)u\in R(w).

  1. (a)

    If xWfragmentsxWx\in W, then xwxuwfragmentsxwxuwx\leq w\Leftrightarrow xu\leq w.

  2. (b)

    If xwfragmentsxwx\leq w, then qwx=qwxufragmentsq𝑤𝑥q𝑤fragmentsxuq^{w}_{x}=q^{w}_{xu}.

  3. (c)

    Let xwfragmentsxwx\leq w. The point xfragmentsxBx\mathcal{B} is rationally smooth (resp. smooth) in XwfragmentsX𝑤X_{w} \Leftrightarrow the point xufragmentsxuBxu\mathcal{B} is rationally smooth (resp. smooth) in XwfragmentsX𝑤X_{w}.

  4. (d)

    Let xwfragmentsxwx\leq w. The Lookup Conjecture holds for the pair xwfragmentsxwx\leq w \Leftrightarrow the Lookup Conjecture holds for the pair xuwfragmentsxuwxu\leq w.

Proof.

The proposition holds if u𝑢u is a simple reflection, by [BoGr:03] or [GrLi:21], except for the assertion about smoothness, which is [GrLi:15, Proposition 2.5(d)]. In general, we can write u𝑢u as a product of simple generators of R(w)fragmentsR(w)R(w); the result then follows by induction on (u)fragments(u)\ell(u). ∎

2.3. The Setup Move

The Setup Move was introduced in [BoGr:03] to study rational smoothness. In this paper, we will use the Setup Move to help determine the smooth locus of XwfragmentsX𝑤X_{w}. Suppose that

xw and s is a simple reflection such that w<ws but xsw.fragmentsxw and s is a simple reflection such that wws but xsw.x\leq w\text{ and }s\text{ is a simple reflection such that }w<ws\text{ but }xs\not\leq w. (2.3)

In this situation, we say x,w,fragmentsx,w,x,w, and s𝑠s satisfy the hypotheses of the Setup Move (on the right); in this case, xs<wsfragmentsxswsxs<ws by [BoGr:03, Lemma 2.3] (the Maximum Principle). We will say that the pair (xs,ws)fragments(xs,ws)(xs,ws) is obtained from the pair (x,w)fragments(x,w)(x,w) by the Setup Move. There is also a Setup Move on the left, where the simple reflection s𝑠s multiplies on the left, and the analogous results hold.

Proposition 2.2.

Suppose x,wfragmentsx,wx,w and s𝑠s satisfy (2.3). The point xfragmentsxBx\mathcal{B} is rationally smooth (resp. smooth) in XwfragmentsX𝑤X_{w} \Leftrightarrow the point xsfragmentsxsBxs\mathcal{B} is rationally smooth (resp. smooth) in XwsfragmentsXfragmentswsX_{ws}.

The assertion about rational smoothness is proved exactly as in [BoGr:03, Prop. 4.12]. To prove the assertion about smoothness, we need to use Kumar’s criterion for smoothness in terms of equivariant multiplicities. This is the only point in the paper where we use equivariant multiplicities, and we will need to briefly recall some background about these. The reader who is willing to accept this proposition can skip the rest of this section.

The real roots of the Kac-Moody group are certain linear combinations of the simple roots β0,β1,,βnfragmentsβ0,β1,,β𝑛\beta_{0},\beta_{1},\ldots,\beta_{n}. Here βi=αifragmentsβ𝑖α𝑖\beta_{i}=\alpha_{i} for i=1,,nfragmentsi1,,ni=1,\ldots,n, where α1,,αnfragmentsα1,,α𝑛\alpha_{1},\ldots,\alpha_{n} are simple roots for the finite Lie algebra, together with an additional root β0fragmentsβ0\beta_{0}. (We introduce the notation βifragmentsβ𝑖\beta_{i}, rather than using αifragmentsα𝑖\alpha_{i}, because we wish to reserve the notation α0fragmentsα0\alpha_{0} for the longest finite root.) The Weyl group acts on the set of real roots; this action is characterized by the formula si(βj)=βjaijβifragmentss𝑖(β𝑗)β𝑗afragmentsijβ𝑖s_{i}(\beta_{j})=\beta_{j}-a_{ij}\beta_{i} for ijfragmentsiji\neq j in {0,1,,n}fragments{0,1,,n}\{0,1,\ldots,n\}. Here the aijfragmentsafragmentsija_{ij} are the entries of the generalized Cartan matrix constructed from the root system ΦΦ\Phi; see [Kum:02, Section 13.1]. If ΦΦ\Phi is of type A2fragmentsA2A_{2}, the case of interest in this paper, then n=2fragmentsn2n=2 and aij=1fragmentsafragmentsij1a_{ij}=-1 for ijfragmentsiji\neq j, so si(βj)=βj+βifragmentss𝑖(β𝑗)β𝑗β𝑖s_{i}(\beta_{j})=\beta_{j}+\beta_{i} for ijfragmentsiji\neq j. Corresponding to each real root β𝛽\beta there is a reflection sβfragmentss𝛽s_{\beta}. Under our identification of W𝑊W with transformations of nfragmentsR𝑛\mathbb{R}^{n}, each sβfragmentss𝛽s_{\beta} corresponds to sα,nfragmentssfragmentsα,ns_{\alpha,n} for some αΦfragmentsαΦ\alpha\in\Phi and some nfragmentsnZn\in\mathbb{Z}. For type A~2fragments~𝐴2\widetilde{A}_{2}, this correspondence is described in [GrLi:15, Prop. 2.6]. Let ΨwxfragmentsΨ𝑤𝑥\Psi^{w}_{x} be the set of positive real roots β𝛽\beta such that sβxwfragmentss𝛽xws_{\beta}x\leq w. We denote by ΨwxfragmentsproductΨ𝑤𝑥\prod\Psi^{w}_{x} the product of the elements in ΨwxfragmentsΨ𝑤𝑥\Psi^{w}_{x}.

The following result is analogous to [BoGr:03, Prop. 4.11], and has a similar proof, which we omit.

Proposition 2.3.

Suppose x,wfragmentsx,wx,w and s=sβfragmentsss𝛽s=s_{\beta} satisfy (2.3). Then

Ψwsxs=Ψwx{xβ}.fragmentsΨfragmentswsfragmentsxsΨ𝑤𝑥square-union{xβ}.\Psi^{ws}_{xs}=\Psi^{w}_{x}\sqcup\{x\beta\}. (2.4)

Given xwfragmentsxwx\leq w in W𝑊W, the equivariant multiplicity ewxfragmentse𝑤𝑥e^{w}_{x} is a rational function in the βifragmentsβ𝑖\beta_{i}, defined as follows. Write si=sβifragmentss𝑖sfragmentsβ𝑖s_{i}=s_{\beta_{i}}. Let 𝒮=(si1,,si)fragmentsS(sfragmentsi1,,sfragmentsi)\mathcal{S}=(s_{i_{1}},\ldots,s_{i_{\ell}}) be a fixed reduced expression for w𝑤w; that is, si1si=wfragmentssfragmentsi1sfragmentsiws_{i_{1}}\cdots s_{i_{\ell}}=w and =(w)fragments(w)\ell=\ell(w) . A subexpression of 𝒮𝒮\mathcal{S} is a sequence σ=(σ1,,σ)fragmentsσ(σ1,,σ)\sigma=(\sigma_{1},\ldots,\sigma_{\ell}) such that each σjfragmentsσ𝑗\sigma_{j} equals either e𝑒e or sijfragmentssfragmentsi𝑗s_{i_{j}}. Let 𝒮(x)fragmentsS(x)\mathcal{S}(x) denote the set of subexpressions σ𝜎\sigma of 𝒮𝒮\mathcal{S} such that σ1σ2σ=xfragmentsσ1σ2σx\sigma_{1}\sigma_{2}\cdots\sigma_{\ell}=x (“σ𝜎\sigma multiplies to x𝑥x”). Then

ewx=(1)(w)σ𝒮(x)j=11σ1σj(βij)fragmentse𝑤𝑥(1)fragments(w)fragmentsσS(x)productfragmentsj11fragmentsσ1σ𝑗(βfragmentsi𝑗)e^{w}_{x}=(-1)^{\ell(w)}\sum_{\sigma\in\mathcal{S}(x)}\ \prod_{j=1}^{\ell}\frac{1}{\sigma_{1}\cdots\sigma_{j}(\beta_{i_{j}})}

(see [Kum:02, Theorem 11.1.2]). The point xfragmentsxBx\mathcal{B} is smooth in XwfragmentsX𝑤X_{w} if and only if ewx=(1)(w)(x)/Ψwxfragmentse𝑤𝑥(1)fragments(w)(x)productΨ𝑤𝑥e^{w}_{x}={(-1)^{\ell(w)-\ell(x)}}/{\prod\Psi^{w}_{x}} [Kum:02, Theorem 12.1.11].

Proof of Proposition 2.2. As noted immediately after the statement of the proposition, we need only prove the assertion about smoothness. We assume x,wfragmentsx,wx,w and s=sβfragmentsss𝛽s=s_{\beta} satisfy (2.3), with 𝒮𝒮\mathcal{S} as above. Observe that

ewsxs=1xβewx.fragmentsefragmentswsfragmentsxs1fragmentsxβe𝑤𝑥.e^{ws}_{xs}=\frac{1}{x\beta}e^{w}_{x}. (2.5)

Indeed, 𝒮=(si1,,si,s)fragmentsS(sfragmentsi1,,sfragmentsi,s)\mathcal{S}^{\prime}=(s_{i_{1}},\ldots,s_{i_{\ell}},s) is a reduced expression for wsfragmentswsws. Moreover, since xswfragmentsxswxs\not\leq w, and in particular x<xsfragmentsxxsx<xs, 𝒮(xs)fragmentsS(xs)\mathcal{S}^{\prime}(xs) consists of the subexpressions (σ1,,σ,s)fragments(σ1,,σ,s)(\sigma_{1},\ldots,\sigma_{\ell},s), where (σ1,,σ)𝒮(x)fragments(σ1,,σ)S(x)(\sigma_{1},\ldots,\sigma_{\ell})\in\mathcal{S}(x). Equation (2.5) follows from these observations and the definition of equivariant multiplicities.

It follows from Proposition 2.3 that

Ψwsxs=xβΨwx.fragmentsproductΨfragmentswsfragmentsxsxβproductΨ𝑤𝑥.\prod\Psi^{ws}_{xs}=x\beta\prod\Psi^{w}_{x}. (2.6)

By Kumar’s criterion, xfragmentsxBx\mathcal{B} is smooth in XwfragmentsX𝑤X_{w} if and only if ewx=(1)(w)(x)Ψwxfragmentse𝑤𝑥fragments(1)fragments(w)(x)fragmentsproductΨ𝑤𝑥e^{w}_{x}=\frac{(-1)^{\ell(w)-\ell(x)}}{\prod\Psi^{w}_{x}}. By (2.5), (2.6), and Kumar’s criterion again, this holds if and only if

ewsxs=1xβ(1)(w)(x)Ψwx=(1)(ws)(xs)Ψwsxsxs is smooth in Xws.fragmentsefragmentswsfragmentsxs1fragmentsxβfragments(1)fragments(w)(x)fragmentsproductΨ𝑤𝑥fragments(1)fragments(ws)(xs)fragmentsproductΨfragmentswsfragmentsxsiffxsB is smooth in Xfragmentsws.e^{ws}_{xs}=\frac{1}{x\beta}\cdot\frac{(-1)^{\ell(w)-\ell(x)}}{\prod\Psi^{w}_{x}}=\frac{(-1)^{\ell(ws)-\ell(xs)}}{\prod\Psi^{ws}_{xs}}\iff xs\mathcal{B}\text{ is smooth in }X_{ws}.

This proves the proposition. \Box

Remark 2.4.

As noted above, the analogue of Proposition 2.2 holds for the Setup Move on the left. Under the hypotheses of the Setup Move on the left, the analogue of Proposition 2.3 is

Ψswsx=s(Ψwx){β},fragmentsΨfragmentsswfragmentssxs(Ψ𝑤𝑥)square-union{β},\Psi^{sw}_{sx}=s(\Psi^{w}_{x})\sqcup\{\beta\}, (2.7)

and the analogue of (2.5) is

eswsx=1βs(ewx).fragmentsefragmentsswfragmentssx1𝛽s(e𝑤𝑥).e^{sw}_{sx}=\frac{1}{\beta}s(e^{w}_{x}). (2.8)
Remark 2.5.

There are analogues of Proposition 2.3 and equation (2.5) for the Simple Move (see [GrLi:15, Prop. 2.5]).

Remark 2.6.

Given x𝑥x and w𝑤w in W𝑊W, it is well-known that xwfragmentsxwx\leq w if and only if any reduced expression for w𝑤w contains a subexpression multiplying to x𝑥x (see [Hum:90, Theorem 5.10]). This connection between the Bruhat order and subexpressions plays a key role in the proof of Theorem 4.1, so to emphasize it, we will sometimes use the phrase “x𝑥x is a subexpression of w𝑤w” to mean xwfragmentsxwx\leq w.

3. Root strips, root strings and chambers

In this section, we define root strips, root strings and chambers, which play a major role in this paper. For the remainder of the paper, W𝑊W will denote the affine Weyl group of type A~2fragments~𝐴2\widetilde{A}_{2}.

3.1. Definitions and length results

This section contains definitions, as well as some results about how the length of an element changes under various operations, which will be needed later.

Fix α{α1,α2,α~=:α0}fragmentsα{α1,α2,~𝛼:α0}\alpha\in\{\alpha_{1},\alpha_{2},\widetilde{\alpha}\ =:\alpha_{0}\}, and kfragmentskZk\in\mathbb{Z}. An α𝛼\alpha root string is a line parallel to α𝛼\alpha passing through some alcove center wqfragmentswqwq.

The region {vVk(α,v)k+1}fragments{vVk(α,v)k1}\{v\in V\mid k\leq(\alpha,v)\leq k+1\} is called an α𝛼\alpha root strip. It is a union of alcove closures. We will also sometimes refer to the set of centers of those alcoves, or the corresponding elements of W𝑊W, as a root strip. The fundamental root strips are those with k=0fragmentsk0k=0. The elements w𝑤w belonging to the fundamental root strips are the spiral elements of [GrLi:21]. For the purposes of this paper, we will refer to chambers as the connected components of the complement of the union of the fundamental root strips (or sometimes, their closures). The boundary of a chamber is the union of two rays along root hyperplanes (with k=0fragmentsk0k=0 or 1); we will refer to these root hyperplanes (or sometimes, the rays) as the walls of the chamber.

Hα2,0fragmentsHfragmentsα2,0H_{\alpha_{2},0}Hα2,1fragmentsHfragmentsα2,1H_{\alpha_{2},1}00Hα1,0fragmentsHfragmentsα1,0H_{\alpha_{1},0}Hα1,1fragmentsHfragmentsα1,1H_{\alpha_{1},1}Hα~,0fragmentsHfragments~𝛼,0H_{\widetilde{\alpha},0}Hα~,1fragmentsHfragments~𝛼,1H_{\widetilde{\alpha},1}q𝑞qα1fragmentsα1\alpha_{1}α2fragmentsα2\alpha_{2}α~~𝛼\widetilde{\alpha}IIIIIIIVVVI
Figure 1. Alcove geometry for A~2fragments~𝐴2\widetilde{A}_{2}

Figure 1 shows the alcove and chamber geometry. (In this and subsequent figures, the origin is denoted by a large red dot.) For the sake of normalizing figures and geometric terminology, we assume that the simple roots α1fragmentsα1\alpha_{1} and α2fragmentsα2\alpha_{2} make angles of π/6fragmentsπ6-\pi/6 and π/2fragmentsπ2\pi/2 with the positive x𝑥x-axis, respectively. Then the root hyperplanes (which are lines) and root strips are at angles which are integral multiples of π/3fragmentsπ3\pi/3. The alcoves are equilateral triangles with one edge horizontal and the opposite vertex either above or below; we call these “Up” and “Down,” respectively. (In [GrLi:21] they were referred to as “Even” and “Odd.”) We number the chambers I, II, …, VI beginning with the chamber in the first quadrant and proceeding counterclockwise, as shown in Figure 1. The alcove centers on a fundamental strip form a line through q𝑞q (the center of AfragmentsAA_{\circ}); we will call the portion of the strip whose alcove centers lie on one of the two rays on this line (starting at q𝑞q) a fundamental half-strip. The chambers numbered I, III, and V (resp.  II, IV, VI) are called odd (resp. even) chambers.

Assume wefragmentswew\neq e. Then there is at least one simple reflection s𝑠s (resp. t𝑡t) such that w<wsfragmentswwsw<ws (resp. w>wtfragmentswwtw>wt). We call w𝑤w of Type τ𝜏\tau (τ=1,2fragmentsτ1,2\tau=1,2) if the number of simple reflections s𝑠s such that w<wsfragmentswwsw<ws is exactly τ𝜏\tau. Evidently when w𝑤w is of Type τ𝜏\tau there are exactly 3τfragments3τ3-\tau simple reflections t𝑡t such that w>wtfragmentswwtw>wt. Note also that when w<wsfragmentswwsw<ws (for s𝑠s simple), if w𝑤w is of Type 1 then wsfragmentswsws is of Type 2; the converse is true if and only if w𝑤w is not a spiral element. This is the reason some of the inductive procedures of this paper do not work for spiral elements.

Recall that for x,yfragmentsx,yx,y in W𝑊W, H(x,y)fragmentsH(x,y)H(x,y) denotes the set of root hyperplanes separating the alcoves xA0fragmentsxA0xA_{0} and yA0fragmentsyA0yA_{0}. The sets H(x,e)fragmentsH(x,e)H(x,e) and H(y,e)fragmentsH(y,e)H(y,e) can differ only by the hyperplanes in H(x,y)fragmentsH(x,y)H(x,y). Precisely, we have:

Lemma 3.1.

Let x,yWfragmentsx,yWx,y\in W. If E𝐸E is a root hyperplane not in H(x,y)fragmentsH(x,y)H(x,y), then either E𝐸E is in both of the sets H(x,e)fragmentsH(x,e)H(x,e) and H(y,e)fragmentsH(y,e)H(y,e), or in neither of them.

Proof.

If E𝐸E is not in H(x,y)fragmentsH(x,y)H(x,y), then xA0fragmentsxA0xA_{0} and yA0fragmentsyA0yA_{0} lie on the same side of E𝐸E. If A0fragmentsA0A_{0} lies on this side of E𝐸E, then E𝐸E is in neither of H(x,e)fragmentsH(x,e)H(x,e) and H(y,e)fragmentsH(y,e)H(y,e); if A0fragmentsA0A_{0} is on the other side of E𝐸E, then E𝐸E is in both of them. ∎

The following useful lemma describes how the length of an element changes when we reflect across the edge of a certain root strip.

Lemma 3.2.

Let E𝐸E be an edge of a fundamental root strip 𝒮𝒮\mathcal{S}. There are three chambers for which this edge is the closer of the two edges of 𝒮𝒮\mathcal{S} to the chamber. Let 𝒞𝒞\mathcal{C} be one of these chambers, let zWfragmentszWz\in W be in 𝒞𝒞\mathcal{C}, and let zWfragmentszWz^{\prime}\in W be obtained by reflecting z𝑧z across E𝐸E. Then (z)<(z)fragments(z)(z)\ell(z^{\prime})<\ell(z), so z<zfragmentszzz^{\prime}<z. More precisely, if EA0fragmentsEA0E\cap A_{0} is the vertex of 𝒞𝒞\mathcal{C}, then (z)=(z)3fragments(z)(z)3\ell(z^{\prime})=\ell(z)-3. In all other cases, (z)=(z)1fragments(z)(z)1\ell(z^{\prime})=\ell(z)-1; in particular, this is always the case when a ray along E𝐸E is a boundary of 𝒞𝒞\mathcal{C}.

Proof.

The fact that there are three chambers for which E𝐸E is the closer of the two edges of 𝒮𝒮\mathcal{S} to the chamber can be seen by inspection: they are the three chambers on the opposite side of E𝐸E from 𝒮𝒮\mathcal{S}.

Let r𝑟r be reflection across E𝐸E, so z=rzfragmentszrzz^{\prime}=rz. We have H(rz,r)=rH(z,e)fragmentsH(rz,r)rH(z,e)H(rz,r)=rH(z,e). Moreover, (z)=|H(z,e)|fragments(z)|H(z,e)|\ell(z)=|H(z,e)| and (z)=|H(rz,e)|fragments(z)|H(rz,e)|\ell(z^{\prime})=|H(rz,e)|. Our hypothesis implies that E𝐸E is in H(z,e)fragmentsH(z,e)H(z,e), since e𝑒e belongs to 𝒮𝒮\mathcal{S}. Since zA0fragmentszA0zA_{0} and A0fragmentsA0A_{0} are on opposite sides of E𝐸E, E𝐸E is not in H(rz,e)fragmentsH(rz,e)H(rz,e).

First suppose EA0fragmentsEA0E\cap A_{0} is an edge of A0fragmentsA0A_{0}. Then E𝐸E is the only root hyperplane separating A0fragmentsA0A_{0} and rA0fragmentsrA0rA_{0} (that is, in H(r,e)fragmentsH(r,e)H(r,e)). By the preceding paragraph and Lemma 3.1, H(rz,r)=H(rz,e){E}fragmentsH(rz,r)H(rz,e)square-union{E}H(rz,r)=H(rz,e)\sqcup\{E\}. Hence

(z)=|H(rz,e)|=|H(rz,r)|1=|H(z,e)|1=(z)1,fragments(z)|H(rz,e)||H(rz,r)|1|H(z,e)|1(z)1,\ell(z^{\prime})=|H(rz,e)|=|H(rz,r)|-1=|H(z,e)|-1=\ell(z)-1,

proving the lemma in this case.

Next suppose that EA0fragmentsEA0E\cap A_{0} is a vertex p𝑝p of A0fragmentsA0A_{0}. There are 333 hyperplanes E,H,HfragmentsE,H,HE,H,H^{\prime} between A0fragmentsA0A_{0} and rA0fragmentsrA0rA_{0}. We have rE=EfragmentsrEErE=E and rH=HfragmentsrHHrH=H^{\prime}. If p𝑝p is the vertex of the chamber 𝒞𝒞\mathcal{C} containing z𝑧z, then each of E,HfragmentsE,HE,H, and HfragmentsHH^{\prime} is in H(z,e)fragmentsH(z,e)H(z,e), and H(rz,r)=H(rz,e){E,H,H}fragmentsH(rz,r)H(rz,e)square-union{E,H,H}H(rz,r)=H(rz,e)\sqcup\{E,H,H^{\prime}\}. Reasoning as above, we see that (z)=(z)3fragments(z)(z)3\ell(z^{\prime})=\ell(z)-3. If p𝑝p is not the vertex of 𝒞𝒞\mathcal{C}, then one of the hyperplanes H,HfragmentsH,HH,H^{\prime} is in H(z,e)fragmentsH(z,e)H(z,e), and the other is not. By relabelling, we may assume H𝐻H is in H(z,e)fragmentsH(z,e)H(z,e). Then

H(rz,r)=(H(rz,e){H,E}){H}.fragmentsH(rz,r)(H(rz,e)square-union{H,E}){H}.H(rz,r)=(H(rz,e)\sqcup\{H^{\prime},E\})\smallsetminus\{H\}.

Hence (z)=(z)1fragments(z)(z)1\ell(z^{\prime})=\ell(z)-1. ∎

Remark 3.3.

In the setting of Lemma 3.2, there is at most one chamber 𝒞𝒞\mathcal{C} such that (z)=(z)3fragments(z)(z)3\ell(z^{\prime})=\ell(z)-3. Such a chamber exists exactly when E𝐸E intersects the fundamental alcove A0fragmentsA0A_{0} in a vertex p𝑝p of A0fragmentsA0A_{0}; then p𝑝p is also the vertex of 𝒞𝒞\mathcal{C}.

One application of Lemma 3.2 is the following proposition, which relates the chambers to the groups L(w)fragmentsL(w)L(w).

Proposition 3.4.

Let 𝒞𝒞\mathcal{C} be a chamber, and let w𝒞fragmentswCw\in\mathcal{C}.

(a) If 𝒞𝒞\mathcal{C} is an even chamber, then the reflection across each wall of the chamber is a simple reflection (on the left). If s𝑠s is either of those simple reflections, then sw<wfragmentsswwsw<w. Thus, L(w)fragmentsL(w)L(w) is a Coxeter group of type A2fragmentsA2A_{2} generated by these two simple reflections.

(b) If 𝒞𝒞\mathcal{C} is an odd chamber, then neither of the reflections across a wall of this chamber is simple (on the left), so L(w)fragmentsL(w)L(w) is the group with two elements.

Proof.

Lemma 3.2 implies that if r𝑟r is the reflection across a wall of 𝒞𝒞\mathcal{C}, then rw<wfragmentsrwwrw<w. One can verify by inspection that if 𝒞𝒞\mathcal{C} is even (resp. odd) then both (resp. neither) of the reflections across a wall of the chamber is simple. (The simple reflections on the left correspond to the thick green, red, and blue lines in Figure 1.) Thus, if 𝒞𝒞\mathcal{C} is even, then L(w)fragmentsL(w)L(w) contains both of these simple reflections, and the remaining assertions about L(w)fragmentsL(w)L(w) follow (see Section 2.1). If 𝒞𝒞\mathcal{C} is odd, and if s𝑠s is a reflection across a wall of 𝒞𝒞\mathcal{C}, then this wall is the nearer edge of a root strip to 𝒞𝒞\mathcal{C}. The reflection t𝑡t across the other edge of this root strip is simple. Applying Lemma 3.2 to the element twfragmentstwtw, we see that t(tw)<twfragmentst(tw)twt(tw)<tw, so w<twfragmentswtww<tw. Hence t𝑡t is not in L(w)fragmentsL(w)L(w). This excludes two of the simple reflections from L(w)fragmentsL(w)L(w), so L(w)fragmentsL(w)L(w) contains only one simple reflection (across a hyperplane not parallel to a wall of 𝒞𝒞\mathcal{C}). Hence L(w)fragmentsL(w)L(w) is a Weyl group of type A1fragmentsA1A_{1} with two elements. ∎

Lemma 3.5.

Let 𝒞𝒞\mathcal{C} be a chamber. There is a unique αΦfragmentsαΦ\alpha\in\Phi with the following property: If z𝒞fragmentszCz\in\mathcal{C}, then t(α)z=z+α𝒞fragmentst(α)zzαCt(\alpha)z=z+\alpha\in\mathcal{C}. In this case, we say α𝛼\alpha points into the chamber 𝒞𝒞\mathcal{C}.

Proof.

The root α𝛼\alpha is the one parallel to the angle bisector of the chamber, in the direction from the chamber vertex into the chamber. See Figure 1. Specifically, for chambers I, II, III, α=α~,α2,α1fragmentsα~𝛼,α2,α1\alpha=\widetilde{\alpha},\ \alpha_{2},-\alpha_{1}, respectively, and for chambers IV, V, VI, the negatives of those. ∎

There is a bijection between the set of chambers and ΦΦ\Phi, which takes a chamber 𝒞𝒞\mathcal{C} to the unique root αΦfragmentsαΦ\alpha\in\Phi which points into 𝒞𝒞\mathcal{C}. Given a non-spiral element w𝑤w, there is an operation of “translation into the chamber” which takes w𝑤w to w=t(α)wfragmentswt(α)ww^{\prime}=t(\alpha)w, where α𝛼\alpha is the root pointing into the chamber containing w𝑤w. In Section 5, we will make use of the following result.

Proposition 3.6.

Suppose w𝑤w is a non-spiral element of W𝑊W. Let wfragmentsww^{\prime} be the element obtained by translating w𝑤w into the chamber. Then w>wfragmentswww^{\prime}>w, and (w)=(w)+4fragments(w)(w)4\ell(w^{\prime})=\ell(w)+4.

To prove this proposition, we use the following lemma.

Lemma 3.7.

Suppose wWfragmentswWw\in W is a non-spiral element. Let α𝛼\alpha be the root pointing into the chamber 𝒞𝒞\mathcal{C} containing w𝑤w, and suppose the alcove wA0fragmentswA0wA_{0} is between the hyperplanes Hα,k1fragmentsHfragmentsα,k1H_{\alpha,k-1} and Hα,kfragmentsHfragmentsα,kH_{\alpha,k}. Then k1fragmentsk1k\geq 1. If wA0Hα,kfragmentswA0Hfragmentsα,kwA_{0}\cap H_{\alpha,k} is an edge of wA0fragmentswA0wA_{0}, then (sα,kw)=(w)+1fragments(sfragmentsα,kw)(w)1\ell(s_{\alpha,k}w)=\ell(w)+1. If wA0Hα,kfragmentswA0Hfragmentsα,kwA_{0}\cap H_{\alpha,k} is a vertex of wA0fragmentswA0wA_{0}, then (sα,kw)=(w)+3fragments(sfragmentsα,kw)(w)3\ell(s_{\alpha,k}w)=\ell(w)+3.

Proof.

The inequality k1fragmentsk1k\geq 1 holds because for any p𝒞fragmentspCp\in\mathcal{C}, we have (α,p)0fragments(α,p)0(\alpha,p)\geq 0, as can be seen by inspection. Let w=sα,kwfragmentswsfragmentsα,kww^{\prime}=s_{\alpha,k}w. If wA0Hα,kfragmentswA0Hfragmentsα,kwA_{0}\cap H_{\alpha,k} is an edge of wA0fragmentswA0wA_{0}, then H(w,w)={Hα,k}fragmentsH(w,w){Hfragmentsα,k}H(w,w^{\prime})=\{H_{\alpha,k}\}, and H(w,e)=H(w,e){Hα,k}fragmentsH(w,e)H(w,e)square-union{Hfragmentsα,k}H(w^{\prime},e)=H(w,e)\sqcup\{H_{\alpha,k}\}, so (sα,kw)=(w)+1fragments(sfragmentsα,kw)(w)1\ell(s_{\alpha,k}w)=\ell(w)+1. If wA0Hα,kfragmentswA0Hfragmentsα,kwA_{0}\cap H_{\alpha,k} is a vertex of wA0fragmentswA0wA_{0}, then the edges of wA0fragmentswA0wA_{0} are the intersections of wA0fragmentswA0wA_{0} with Hα,k+1fragmentsHfragmentsα,k1H_{\alpha,k+1} and two other hyperplanes H,HfragmentsH,HH,H^{\prime}. The hyperplanes H𝐻H and HfragmentsHH^{\prime} are parallel to the edges of 𝒞𝒞\mathcal{C}, and H(w,w)={Hα,k,H,H}fragmentsH(w,w){Hfragmentsα,k,H,H}H(w,w^{\prime})=\{H_{\alpha,k},H,H^{\prime}\}. Moreover, none of the hyperplanes in H(w,w)fragmentsH(w,w)H(w,w^{\prime}) are in H(w,e)fragmentsH(w,e)H(w,e). Since H(w,e)=H(w,e){Hα,k,H,H}fragmentsH(w,e)H(w,e)square-union{Hfragmentsα,k,H,H}H(w^{\prime},e)=H(w,e)\sqcup\{H_{\alpha,k},H,H^{\prime}\}, we have (sα,kw)=(w)+3fragments(sfragmentsα,kw)(w)3\ell(s_{\alpha,k}w)=\ell(w)+3. ∎

Proof of Proposition 3.6. Let α𝛼\alpha be the root pointing into the chamber of w𝑤w. Then wA0fragmentswA0wA_{0} is between Hα,k1fragmentsHfragmentsα,k1H_{\alpha,k-1} and Hα,kfragmentsHfragmentsα,kH_{\alpha,k} for some k1fragmentsk1k\geq 1. Let u=sα,kwfragmentsusfragmentsα,kwu=s_{\alpha,k}w; then uA0fragmentsuA0uA_{0} is between Hα,kfragmentsHfragmentsα,kH_{\alpha,k} and Hα,k+1fragmentsHfragmentsα,k1H_{\alpha,k+1}. Moreover, w=t(α)w=sα,k+1sα,kw=sα,k+1ufragmentswt(α)wsfragmentsα,k1sfragmentsα,kwsfragmentsα,k1uw^{\prime}=t(\alpha^{\vee})w=s_{\alpha,k+1}s_{\alpha,k}w=s_{\alpha,k+1}u. By Lemma 3.7, either (u)=(w)+1fragments(u)(w)1\ell(u)=\ell(w)+1 and (w)=(u)+3fragments(w)(u)3\ell(w^{\prime})=\ell(u)+3, or (u)=(w)+3fragments(u)(w)3\ell(u)=\ell(w)+3 and (w)=(u)+1fragments(w)(u)1\ell(w^{\prime})=\ell(u)+1. In either case, (w)=(w)+4fragments(w)(w)4\ell(w^{\prime})=\ell(w)+4, and by the definition of the Bruhat order, w>wfragmentswww^{\prime}>w. \Box

3.2. Alcove edge labels

Hα2,0fragmentsHfragmentsα2,0H_{\alpha_{2},0}Hα2,1fragmentsHfragmentsα2,1H_{\alpha_{2},1}00Hα1,0fragmentsHfragmentsα1,0H_{\alpha_{1},0}Hα1,1fragmentsHfragmentsα1,1H_{\alpha_{1},1}Hα~,0fragmentsHfragments~𝛼,0H_{\widetilde{\alpha},0}Hα~,1fragmentsHfragments~𝛼,1H_{\widetilde{\alpha},1}q𝑞qα1fragmentsα1\alpha_{1}α2fragmentsα2\alpha_{2}α~~𝛼\widetilde{\alpha}IIIIIIIVVVI012122012102012011b𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle bc𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle bq𝑞\scriptscriptstyle qa𝑎\scriptscriptstyle aa𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle aE𝐸\scriptstyle EEfragmentsE\scriptstyle E^{\prime}
Figure 2. Labels on alcove walls

In this subsection we briefly describe the right action of simple reflections on alcoves in terms of a certain labeling of the alcove walls (see Figure 2). Begin by labeling the three walls of AfragmentsAA_{\circ} by 1, 2, 0 along Hα1,0fragmentsHfragmentsα1,0H_{\alpha_{1},0}, Hα2,0fragmentsHfragmentsα2,0H_{\alpha_{2},0}, and Hα~,1fragmentsHfragments~𝛼,1H_{\widetilde{\alpha},1}, respectively. Recursively, having labeled the walls of an alcove A𝐴A by 1, 2, 0, and given an alcove AfragmentsAA^{\prime} which is the reflection of A𝐴A across one of its walls, label the walls of AfragmentsAA^{\prime} by reflecting the labels on the walls of A𝐴A. See the lower right portion of Figure 2, which shows the labels on the walls of several alcoves near AfragmentsAA_{\circ} (recall its center is denoted q𝑞q). The fact that the labels are consistent when moving around a small hexagon implies that these alcove wall labels are well defined.

The upper left portion of Figure 2 shows the behavior of labels on the walls of some alcoves lying on or near two parallel root strings (depicted in orange). Note that in the small hexagon outlined in bold, the exterior edges all have the same label, a𝑎a, and the interior edges alternate between the other two labels, b𝑏b and c𝑐c. This is a general phenomenon. The proof of the following lemma is straightforward and is left to the reader; see Figure 2.

Lemma 3.8.

(a) Let A,AfragmentsA,AA,A^{\prime} be two alcoves sharing a wall with label a{0,1,2}fragmentsa{0,1,2}a\in\{0,1,2\} and corresponding to elements w,wWfragmentsw,wWw,w^{\prime}\in W, respectively. Then w=wsafragmentswws𝑎w^{\prime}=ws_{a}.

(b) Let A,AfragmentsA,AA,A^{\prime} be two alcoves such that AfragmentsAA^{\prime} is the reflection of A𝐴A across some root hyperplane. Then the labels on AfragmentsAA^{\prime} are the reflections of the labels on A𝐴A.

(c) Given six alcoves sharing a common vertex and forming a small hexagon, the labels on the six exterior edges of the hexagon are all the same, say a𝑎a. The labels on the edges incident to the center of the hexagon alternate between b𝑏b and c𝑐c, where {a,b,c}={0,1,2}fragments{a,b,c}{0,1,2}\{a,b,c\}=\{0,1,2\}.

(d) Given two alcoves lying on a fixed root string, their edges on the same side of the string have the same label. \Box

3.3. Paths and spiral factorizations

It will be convenient to have a geometric criterion for when a product of simple reflections is reduced. Given an expression w=t1t2tmfragmentswt1t2t𝑚w=t_{1}t_{2}\dots t_{m}, where each tifragmentst𝑖t_{i} is a simple reflection, we can define a sequence of alcoves A0=A,A1=t1A,A2=t1t2A,,Am=wAfragmentsA0A,A1t1A,A2t1t2A,,A𝑚wAA_{0}=A_{\circ},\ A_{1}=t_{1}A_{\circ},\ A_{2}=t_{1}t_{2}A_{\circ},\ \dots,\ A_{m}=wA_{\circ}, in which each alcove AifragmentsA𝑖A_{i} is obtained from the previous one Ai1fragmentsAfragmentsi1A_{i-1} by reflecting it across the wall of Ai1fragmentsAfragmentsi1A_{i-1} labeled by tifragmentst𝑖t_{i}. If we shade in all the alcoves A0,,AmfragmentsA0,,A𝑚A_{0},\dots,A_{m}, we obtain a connected, piecewise-linear, directed path 𝒫𝒫\mathcal{P} (whose width is the distance between two adjacent root hyperplanes), from AfragmentsAA_{\circ} to wAfragmentswAwA_{\circ}. We say 𝒫𝒫\mathcal{P} is a reduced path if the expression for w𝑤w is reduced. Such paths are related to the galleries defined in [GaLi:05].

Hα2,0fragmentsHfragmentsα2,0H_{\alpha_{2},0}Hα2,1fragmentsHfragmentsα2,1H_{\alpha_{2},1}00Hα1,0fragmentsHfragmentsα1,0H_{\alpha_{1},0}Hα1,1fragmentsHfragmentsα1,1H_{\alpha_{1},1}Hα~,0fragmentsHfragments~𝛼,0H_{\widetilde{\alpha},0}Hα~,1fragmentsHfragments~𝛼,1H_{\widetilde{\alpha},1}q𝑞qα1fragmentsα1\alpha_{1}α2fragmentsα2\alpha_{2}α~~𝛼\widetilde{\alpha}IIIIIIIVVVI012122012102012011b𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle bc𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle bq𝑞\scriptscriptstyle qa𝑎\scriptscriptstyle aa𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle aE𝐸\scriptstyle EEfragmentsE\scriptstyle E^{\prime}w𝑤we𝑒e
Figure 3. Three reduced paths from e𝑒e to w𝑤w

Figure 3 shows three (reduced) paths from AfragmentsAA_{\circ} to wAfragmentswAwA_{\circ} for a certain w𝑤w in Chamber I. Path segments parallel to α1fragmentsα1\alpha_{1} (resp. α~~𝛼\widetilde{\alpha}) are colored red (resp. green), while segments which would be red in one path and green in another are grey. In coloring this path, we follow the convention implied in Remark 3.11 below: in a path of the form uvfragmentsuvuv, where u𝑢u and v𝑣v are spiral, we make u𝑢u as long as possible, and v𝑣v moves out of the root strip containing u𝑢u. In a zigzag path, we apply this convention iteratively from the left, so the color changes only when the path changes direction.

A chamber is bounded by two fundamental root strip “rays,” each of which is a union of alcoves beginning at AfragmentsAA_{\circ} and extending to infinity. In contrast to our usual convention, for the purposes of the following lemma we will consider the boundary strips to be part of the chamber.

Proposition 3.9.

Suppose w=t1tmfragmentswt1t𝑚w=t_{1}\dots t_{m} as above with associated path 𝒫𝒫\mathcal{P}, and with wAfragmentswAwA_{\circ} belonging to a chamber 𝒞𝒞\mathcal{C}. If the expression is reduced, then every directed linear segment of 𝒫𝒫\mathcal{P} is in the direction of one of the two boundary strip rays of 𝒞𝒞\mathcal{C}.

Proof.

If w𝑤w is spiral, then as noted in [GrLi:15], w𝑤w has a unique reduced expression; the associated path is the portion of the fundamental (spiral) strip from AfragmentsAA_{\circ} to wAfragmentswAwA_{\circ}. (If this were not true, then the path would leave the strip at some point, and at some later point it would have to return, say from Ai1fragmentsAfragmentsi1A_{i-1} to AifragmentsA𝑖A_{i}. But the fact that length equals number of hyperplanes separating the associated alcove from AfragmentsAA_{\circ} implies that (t1ti)=(t1ti1)1fragments(t1t𝑖)(t1tfragmentsi1)1\ell(t_{1}\dots t_{i})=\ell(t_{1}\dots t_{i-1})-1, contradicting the fact that the expression is reduced.)

For w𝑤w non-spiral, the proof is by induction on (w)fragments(w)\ell(w). Set w=wtmfragmentswwt𝑚w^{\prime}=wt_{m}, where (w)=(w)1fragments(w)(w)1\ell(w^{\prime})=\ell(w)-1. It is easy to see that wfragmentsww^{\prime} also lies in 𝒞𝒞\mathcal{C} (because we expanded 𝒞𝒞\mathcal{C} to include both its boundary strips). If wfragmentsww^{\prime} is of Type 2 then the path from wfragmentsww^{\prime} to w𝑤w is in one of the two 𝒞𝒞\mathcal{C} edge strip directions from wAfragmentswAw^{\prime}A_{\circ} to wAfragmentswAwA_{\circ}, whereas if wfragmentsww^{\prime} is of Type 1 then the path from wfragmentsww^{\prime} to w𝑤w can be viewed as lying in both of the 𝒞𝒞\mathcal{C} edge strip directions from wAfragmentswAw^{\prime}A_{\circ} to wAfragmentswAwA_{\circ}. Since by induction the linear segments of the path from AfragmentsAA_{\circ} to wAfragmentswAw^{\prime}A_{\circ} all lie in one of the 𝒞𝒞\mathcal{C} edge directions, the same is true for the entire path from AfragmentsAA_{\circ} to wAfragmentswAwA_{\circ}. ∎

Corollary 3.10.

For w𝑤w non-spiral, the path 𝒫𝒫\mathcal{P} associated to any reduced expression for w𝑤w lies entirely within the parallelogram with vertices AfragmentsAA_{\circ} and wAfragmentswAwA_{\circ} and edges parallel to the fundamental root strips bounding the chamber of w𝑤w.

Remark 3.11.

Each non-spiral w𝑤w thus has two canonical reduced expressions, corresponding to the two paths from AfragmentsAA_{\circ} to wAfragmentswAwA_{\circ} along the boundary of the parallelogram described in Corollary 3.10. These canonical paths are illustrated in Figure 3. Since the sequence of alcove edge labels crossed along any segment of a root strip has the pattern abcabcfragmentsabcabcabcabc\dots, we have two canonical factorizations w=uvfragmentswuvw=uv where u𝑢u and v𝑣v are spiral and (u)+(v)=(w)fragments(u)(v)(w)\ell(u)+\ell(v)=\ell(w). We will always assume that u𝑢u is as long as possible in its fundamental root strip, so that uv1fragmentsuv1uv_{1} lies outside that strip, where v1fragmentsv1v_{1} is the first simple reflection in the (unique!) reduced expression for v𝑣v.

Lemma 3.12.

Let E𝐸E and EfragmentsEE^{\prime} be two parallel root strings. Then there is a fixed (spiral) element vWfragmentsvWv\in W such that, for any x𝑥x on E𝐸E, the “corresponding” alcove xfragmentsxx^{\prime} on EfragmentsEE^{\prime} (meaning that x𝑥x and xfragmentsxx^{\prime} lie in the same root strip perpendicular to E𝐸E) is given by x=xvfragmentsxxvx^{\prime}=xv.

Proof.

Since the sequence of edges crossed when moving along any root strip always defines a spiral element of W𝑊W, it suffices to show that, for any two alcoves x𝑥x and y𝑦y on E𝐸E, the first edges crossed when moving from x𝑥x or y𝑦y along root strips perpendicular to E𝐸E and towards EfragmentsEE^{\prime} have the same label. But this follows from Lemma 3.8(d). (See Figure 2, where the edges joining E𝐸E to the adjacent root string EfragmentsEE^{\prime} all have the same label, c𝑐c.) ∎

4. Bruhat hexagons

In this section, we will show that for any (non-spiral) wWfragmentswWw\in W, the set of alcove centers {xqxw}fragments{xqxw}\{xq\mid x\leq w\} is the intersection of the lattice WqfragmentsWqWq with a certain closed convex hexagon in the plane, which we will describe explicitly in two different ways. Although these hexagons are not generally regular, they have more symmetry for even-chamber w𝑤w than for odd-chamber w𝑤w.

Hα2,0fragmentsHfragmentsα2,0H_{\alpha_{2},0}Hα2,1fragmentsHfragmentsα2,1H_{\alpha_{2},1}00Hα1,0fragmentsHfragmentsα1,0H_{\alpha_{1},0}Hα1,1fragmentsHfragmentsα1,1H_{\alpha_{1},1}Hα~,0fragmentsHfragments~𝛼,0H_{\widetilde{\alpha},0}Hα~,1fragmentsHfragments~𝛼,1H_{\widetilde{\alpha},1}q𝑞qα1fragmentsα1\alpha_{1}α2fragmentsα2\alpha_{2}α~~𝛼\widetilde{\alpha}IIIIIIIVVVI012122012102012011b𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle bc𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle bq𝑞\scriptscriptstyle qa𝑎\scriptscriptstyle aa𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle aE𝐸\scriptstyle EEfragmentsE\scriptstyle E^{\prime}w𝑤we𝑒ew3fragmentsw3w_{3}w4fragmentsw4w_{4}w5fragmentsw5w_{5}w=w0fragmentsww0w=w_{0}w1fragmentsw1w_{1}w2fragmentsw2w_{2}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}
Figure 4. A hexagon wfragmentsH𝑤\mathcal{H}_{w} for chamber IV
Hα2,0fragmentsHfragmentsα2,0H_{\alpha_{2},0}Hα2,1fragmentsHfragmentsα2,1H_{\alpha_{2},1}00Hα1,0fragmentsHfragmentsα1,0H_{\alpha_{1},0}Hα1,1fragmentsHfragmentsα1,1H_{\alpha_{1},1}Hα~,0fragmentsHfragments~𝛼,0H_{\widetilde{\alpha},0}Hα~,1fragmentsHfragments~𝛼,1H_{\widetilde{\alpha},1}q𝑞qα1fragmentsα1\alpha_{1}α2fragmentsα2\alpha_{2}α~~𝛼\widetilde{\alpha}IIIIIIIVVVI012122012102012011b𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle bc𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle bq𝑞\scriptscriptstyle qa𝑎\scriptscriptstyle aa𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle aE𝐸\scriptstyle EEfragmentsE\scriptstyle E^{\prime}w𝑤we𝑒ew3fragmentsw3w_{3}w4fragmentsw4w_{4}w5fragmentsw5w_{5}w=w0fragmentsww0w=w_{0}w1fragmentsw1w_{1}w2fragmentsw2w_{2}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}w0=wfragmentsw0ww_{0}=ww1fragmentsw1w_{1}w5fragmentsw5w_{5}w4fragmentsw4w_{4}w3fragmentsw3w_{3}w2fragmentsw2w_{2}
Figure 5. A hexagon wfragmentsH𝑤\mathcal{H}_{w} for chamber I

Assume w𝑤w is not a spiral element, so w𝑤w belongs to some chamber 𝒞𝒞\mathcal{C}. Let Hα,ifragmentsHfragmentsα,iH_{\alpha,i} and Hβ,jfragmentsHfragmentsβ,jH_{\beta,j} be the boundaries of 𝒞𝒞\mathcal{C}, and Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k} be the nearer of the two hyperplanes Hγ,0,Hγ,1fragmentsHfragmentsγ,0,Hfragmentsγ,1H_{\gamma,0},\ H_{\gamma,1} to w𝑤w, where {α,β,γ}={α1,α2,α~}fragments{α,β,γ}{α1,α2,~𝛼}\{\alpha,\beta,\gamma\}=\{\alpha_{1},\alpha_{2},\widetilde{\alpha}\} and i,j,k{0,1}fragmentsi,j,k{0,1}i,j,k\in\{0,1\}. For definiteness, assume that Hα,ifragmentsHfragmentsα,iH_{\alpha,i} is counterclockwise from w𝑤w, so Hβ,jfragmentsHfragmentsβ,jH_{\beta,j} is clockwise from w𝑤w. We define a hexagon wfragmentsH𝑤\mathcal{H}_{w} with vertices w0=w,w1,,w5fragmentsw0w,w1,,w5w_{0}=w,w_{1},\dots,w_{5} labeled counterclockwise from w𝑤w, as follows (see Figures 4, 5):

w1=sα,iw,w5=sβ,jw,w3=sγ,kw,w2=sγ,kw1,w4=sγ,kw5.fragmentsw1sfragmentsα,iw,w5sfragmentsβ,jw,w3sfragmentsγ,kw,w2sfragmentsγ,kw1,w4sfragmentsγ,kw5.w_{1}=s_{\alpha,i}\,w,\quad w_{5}=s_{\beta,j}\,w,\quad w_{3}=s_{\gamma,k}\,w,\quad w_{2}=s_{\gamma,k}\,w_{1},\quad w_{4}=s_{\gamma,k}\,w_{5}. (4.1)

In this paper we will encounter many hexagons like these, with edges parallel to the three positive roots. We will refer to their edges, starting at the right vertical edge and moving counterclockwise, by the compass directions E, NE, NW, W, SW, and SE. For simplicity, we will often say that an alcove lies on an edge if its center does.

Theorem 4.1.

Assume w𝑤w is not a spiral element. The set {xWxw}fragments{xWxw}\{\,x\in W\mid x\leq w\,\} equals the set of x𝑥x whose alcove centers xqfragmentsxqxq lie on or inside wfragmentsH𝑤\mathcal{H}_{w} (“points in the hexagon”).

Remark 4.2.

For spiral elements, the set of xwfragmentsxwx\leq w is again the set of x𝑥x whose alcove centers lie in a convex region which we again denote by wfragmentsH𝑤\mathcal{H}_{w}, although it is not a hexagon. More precisely, for spiral elements of length at least 222, the hexagon degenerates to a quadrilateral: two of its edges become points. For completeness, we describe one of these; the descriptions for spiral elements in the other five fundamental half-strips are analogous. Assume w𝑤w lies in the fundamental α2fragmentsα2\alpha_{2} half-strip to the left of AfragmentsAA_{\circ}; these are the spiral elements considered in [GrLi:21]. We will also assume (w)>1fragments(w)1\ell(w)>1; otherwise, {xw}={1,w}fragments{xw}{1,w}\{x\leq w\}=\{1,w\}. Then the set {xWxw}fragments{xWxw}\{x\in W\mid x\leq w\} has four vertices (again numbered clockwise):

w0=w,w1=sα1w,w3=sα~,0w,w2=sα1w3.fragmentsw0w,w1sfragmentsα1w,w3sfragments~𝛼,0w,w2sfragmentsα1w3.w_{0}=w,\quad w_{1}=s_{\alpha_{1}}w,\quad w_{3}=s_{\widetilde{\alpha},0}w,\quad w_{2}=s_{\alpha_{1}}w_{3}.

All the quadrilateral vertices except (if (w)3fragments(w)3\ell(w)\geq 3) w3fragmentsw3w_{3} lie in fundamental root strips.

The following observations about the geometry of the hexagons will be necessary in describing the rationally smooth locus of XwfragmentsX𝑤X_{w}. If v𝑣v is a vertex of wfragmentsH𝑤\mathcal{H}_{w}, then two of the root strings through v𝑣v contain edges of the hexagon, and the third passes through the interior of the hexagon. We call the portion of this root string inside the hexagon a diagonal. If a diagonal intersects an edge, we refer to this as the opposite edge to the vertex. The diagonal starting at w=w0fragmentsww0w=w_{0} always ends at the opposite vertex, w3fragmentsw3w_{3}; this is part of the next proposition.

Proposition 4.3.

(a) If w𝑤w belongs to an even chamber, the vertices of wfragmentsH𝑤\mathcal{H}_{w} are the orbit L(w)wfragmentsL(w)wL(w)w. The hexagon is symmetric about each of the lines Hα,i,Hβ,j,Hγ,kfragmentsHfragmentsα,i,Hfragmentsβ,j,Hfragmentsγ,kH_{\alpha,i},H_{\beta,j},H_{\gamma,k} used to construct its vertices (although it need not be a regular hexagon; see Figure 4). Every diagonal passes through a pair of opposite vertices.

(b) If w𝑤w belongs to an odd chamber, then the hexagon is symmetric about the line Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}. The diagonals through wifragmentsw𝑖w_{i} for i0,3fragmentsi0,3i\neq 0,3 do not pass through the opposite vertex, but instead intersect the opposite edge at the center of an alcove lying two alcoves away (along a root string) from a vertex alcove. That is, the diagonals through the opposite vertices wifragmentsw𝑖w_{i} and wi+3fragmentswfragmentsi3w_{i+3}, i=1,2fragmentsi1,2i=1,2, are parallel and three root strings apart.

Proof.

Since w3=sγ,kw0fragmentsw3sfragmentsγ,kw0w_{3}=s_{\gamma,k}w_{0}, the vertices w0fragmentsw0w_{0} and w3fragmentsw3w_{3} lie on a diagonal parallel to γ𝛾\gamma, independent of whether the chamber is even or odd. Suppose w𝑤w belongs to an even chamber 𝒞𝒞\mathcal{C}. In the notation of (4.1), Proposition 3.4 implies that s=sα,ifragmentsssfragmentsα,is=s_{\alpha,i} and t=sβ,jfragmentstsfragmentsβ,jt=s_{\beta,j} are simple reflections, and they generate L(w)fragmentsL(w)L(w), which is of type A2fragmentsA2A_{2}. The hyperplanes Hα,ifragmentsHfragmentsα,iH_{\alpha,i}, Hβ,jfragmentsHfragmentsβ,jH_{\beta,j} and Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k} meet at an alcove vertex (see Figure 1), so sγ,k=sts=tstfragmentssfragmentsγ,kstststs_{\gamma,k}=sts=tst. Thus every vertex of wfragmentsH𝑤\mathcal{H}_{w} is obtained from w𝑤w by applying an element of the group generated by s𝑠s and t𝑡t. Hence the vertices of wfragmentsH𝑤\mathcal{H}_{w} are the orbit L(w)wfragmentsL(w)wL(w)w. Since each of the reflections sα,ifragmentssfragmentsα,is_{\alpha,i}, sβ,jfragmentssfragmentsβ,js_{\beta,j}, and sγ,kfragmentssfragmentsγ,ks_{\gamma,k} is in L(w)fragmentsL(w)L(w), these reflections preserve the set L(w)wfragmentsL(w)wL(w)w of vertices, so they preserve the hexagon wfragmentsH𝑤\mathcal{H}_{w}. Hence the hexagon is symmetric about the lines Hα,i,Hβ,j,Hγ,kfragmentsHfragmentsα,i,Hfragmentsβ,j,Hfragmentsγ,kH_{\alpha,i},H_{\beta,j},H_{\gamma,k}. Finally, using the formulas from (4.1), we see that w4=sβ,jw1fragmentsw4sfragmentsβ,jw1w_{4}=s_{\beta,j}w_{1} and w5=sα,iw2fragmentsw5sfragmentsα,iw2w_{5}=s_{\alpha,i}w_{2}. Therefore, w1fragmentsw1w_{1} and w4fragmentsw4w_{4} lie on a diagonal parallel to β𝛽\beta, and w2fragmentsw2w_{2} and w5fragmentsw5w_{5} lie on a diagonal parallel to α𝛼\alpha. This proves (a).

Next suppose w𝑤w belongs to an odd chamber. By construction, sγ,kfragmentssfragmentsγ,ks_{\gamma,k} interchanges the vertices w0fragmentsw0w_{0} and w3fragmentsw3w_{3}, w1fragmentsw1w_{1} and w2fragmentsw2w_{2}, and w4fragmentsw4w_{4} and w5fragmentsw5w_{5}. Hence sγ,kfragmentssfragmentsγ,ks_{\gamma,k} preserves wfragmentsH𝑤\mathcal{H}_{w}, so the hexagon is symmetric about Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}. For the remainder of the proof, assume w𝑤w is in chamber I; the argument will be similar for the other odd chambers. Our assumption implies that sα,i=sα1,1fragmentssfragmentsα,isfragmentsα1,1s_{\alpha,i}=s_{\alpha_{1},1}, sβ,j=sα2,1fragmentssfragmentsβ,jsfragmentsα2,1s_{\beta,j}=s_{\alpha_{2},1}, and sγ,k=sα~,1fragmentssfragmentsγ,ksfragments~𝛼,1s_{\gamma,k}=s_{\widetilde{\alpha},1}. We first consider the diagonal through w4fragmentsw4w_{4}, which is a portion of an α2fragmentsα2\alpha_{2} root string. Direct calculation shows that s2w4=t(α~)w1fragmentss2w4t(~𝛼)w1s_{2}w_{4}=t(-\widetilde{\alpha})w_{1}, which lies two alcoves away from w2fragmentsw2w_{2} on an edge parallel to α~~𝛼\widetilde{\alpha}. This verifies the result for the diagonal through w4fragmentsw4w_{4}; similar calculations show the result for the other diagonals. ∎

It can happen that the diagonals emanating from two adjacent vertices (w1fragmentsw1w_{1} and w2fragmentsw2w_{2}, or w4fragmentsw4w_{4} and w5fragmentsw5w_{5}) cross in the interior of the hexagon, and intersect the opposite edge E𝐸E, say at the centers of alcoves A𝐴A and AfragmentsAA^{\prime} (two alcoves in from the ends of E𝐸E). This happens precisely when E𝐸E is at least 6 alcoves long. We call the alcoves along E𝐸E from A𝐴A to AfragmentsAA^{\prime} (inclusive) a special segment. By Proposition 4.3, a special segment can only exist when w𝑤w belongs to an odd chamber. See Figure 5, where the two special segments are highlighted in purple. When w𝑤w is in an odd chamber, we call w1w2fragmentsw1w2w_{1}w_{2} (resp. w4w5fragmentsw4w5w_{4}w_{5}) a special edge, even if its special segment is empty (which happens when the opposite diagonals do not cross in the hexagon interior).

To prove Theorem 4.1, we will need some preliminary lemmas.

Lemma 4.4.

In the setup of (4.1), w1fragmentsw1w_{1} and w5fragmentsw5w_{5} are on the same side of Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k} as w𝑤w.

Proof.

We will give the proof for w1fragmentsw1w_{1}; the proof for w5fragmentsw5w_{5} is almost identical. Notice that for any of the six chambers, the line Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k} is either disjoint from the chamber closure (for odd chambers), or intersects it only at its vertex (for even chambers). In the second case, the reflection sα,ifragmentssfragmentsα,is_{\alpha,i} takes Hβ,jfragmentsHfragmentsβ,jH_{\beta,j} to Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}, and hence takes points in the chamber (such as w𝑤w) to points on the same side of Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}. In the first case, the reflection takes Hβ,jfragmentsHfragmentsβ,jH_{\beta,j} to the translate of Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k} passing through the vertex of the chamber closure (i.e., closer to the chamber than Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}). So again, reflections of points in the chamber certainly stay on the same side of Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}. ∎

Lemma 4.5.

Let wWfragmentswWw\in W be a non-spiral element, δ{α~,α1,α2}fragmentsδ{~𝛼,α1,α2}\delta\in\{\widetilde{\alpha},\alpha_{1},\alpha_{2}\}, and Hδ,εfragmentsHfragmentsδ,εH_{\delta,\varepsilon} for ε{0,1}fragmentsε{0,1}\varepsilon\in\{0,1\} be the nearer of Hδ,0,Hδ,1fragmentsHfragmentsδ,0,Hfragmentsδ,1H_{\delta,0},H_{\delta,1} to wqfragmentswqwq. Then sδ,εw<wfragmentssfragmentsδ,εwws_{\delta,\varepsilon}w<w.

Proof.

This follows immediately from Lemma 3.2. ∎

Proof of Theorem 4.1.

We first show that all points xqfragmentsxqxq in the hexagon satisfy xwfragmentsxwx\leq w. A key ingredient is the Endpoint Theorem of Graham-Li, [GrLi:21, Theorem 5.5], which says that if xq,yq,zqfragmentsxq,yq,zqxq,yq,zq lie on a root string with yqfragmentsyqyq between xqfragmentsxqxq and zqfragmentszqzq, then either yxfragmentsyxy\leq x or yzfragmentsyzy\leq z. By Lemma 4.5, we have w1,w3,w5<wfragmentsw1,w3,w5ww_{1},w_{3},w_{5}<w. But Lemma 4.4 implies that we may again use Lemma 4.5 to conclude that w2<w1fragmentsw2w1w_{2}<w_{1} and w4<w5fragmentsw4w5w_{4}<w_{5}. So the hexagon vertices satisfy wiwfragmentsw𝑖ww_{i}\leq w for 0i5fragments0i50\leq i\leq 5. Any hexagon edge point lies on a root string interval determined by the endpoints of the edge, so the edge points are all wfragmentsw\leq w by the Endpoint Theorem. Finally, any interior point of the hexagon lies on a root string interval (in fact, three of them) with endpoints on the hexagon edges. So these are all wfragmentsw\leq w by the Endpoint Theorem again.

For the converse, we must show that any xqfragmentsxqxq outside the hexagon has xwfragmentsxnot-less-than-nor-greater-thanwx\nleq w. Evidently it is enough to show that no element lying on one of the six root strings just outside the hexagon, and parallel to the adjacent hexagon edge, is dominated by w𝑤w. But it is clear geometrically that the spiral element on each such root string is less than every other element on the string: one can move from the spiral alcove to any other alcove on the string by a sequence of reflections across a wall of each alcove reached, and the number of hyperplanes separating the alcove from AfragmentsAA_{\circ} increases at each step, by an argument similar to the one used in the proof of Lemma 4.5. (See [GrLi:21, Theorem 5.1] for a more algebraic argument.) So it suffices to prove that the spiral elements just outside the hexagon are wfragmentsnot-less-than-nor-greater-thanw\nleq w. For this we will use an inductive argument which will be a key technique for the remainder of the paper.

We fix an arbitrary fundamental half-strip and in what follows, we will assume that all spiral elements considered lie in this fixed half-strip. Our induction hypothesis is that, for some given (non-spiral) w𝑤w, if y𝑦y is the spiral element (in the fixed fundamental half-strip) on the boundary of wfragmentsH𝑤\mathcal{H}_{w}, and z𝑧z is the next spiral element just outside wfragmentsH𝑤\mathcal{H}_{w}, then ywfragmentsywy\leq w but zwfragmentsznot-less-than-nor-greater-thanwz\nleq w. The induction step will be to prove the same for the element(s) wfragmentsww^{\prime} obtained by reflecting w𝑤w across a wall of wAfragmentswAwA_{\circ} and having (w)=(w)+1fragments(w)(w)1\ell(w^{\prime})=\ell(w)+1. (The base cases, where w𝑤w belongs to the lowest alcove in one of the six chambers, can be checked by a direct computation.)

Before beginning the induction step, we make a simple observation. If w=t1trfragmentswt1t𝑟w=t_{1}\dots t_{r} is a reduced expression (here the tjfragmentst𝑗t_{j} are simple reflections in W𝑊W), and if y=s1skfragmentsys1s𝑘y=s_{1}\dots s_{k} is a subexpression of w𝑤w, say si=tjifragmentss𝑖tfragmentsj𝑖s_{i}=t_{j_{i}} for some indices 1j1<<jkrfragments1j1j𝑘r1\leq j_{1}<\dots<j_{k}\leq r, then, for i=1,2,,kfragmentsi1,2,,ki=1,2,\dots,k, we may choose each jifragmentsj𝑖j_{i} in turn so that tjifragmentstfragmentsj𝑖t_{j_{i}} is the first occurrence of sifragmentss𝑖s_{i} to the right of tji1fragmentstfragmentsjfragmentsi1t_{j_{{i-1}}} in the given expression for w𝑤w. (When i=1fragmentsi1i=1, omit the phrase “to the right of tji1fragmentstfragmentsjfragmentsi1t_{j_{{i-1}}}”.) We call this the leftmost subexpression s1skfragmentss1s𝑘s_{1}\dots s_{k} in t1trfragmentst1t𝑟t_{1}\dots t_{r}. We will assume in what follows that all subexpressions chosen are the leftmost ones. Recall also that each spiral element y𝑦y has a unique reduced expression. This means that ywfragmentsywy\leq w if and only if the unique reduced expression for y𝑦y is a subexpression of any (and every) reduced expression for w𝑤w.

Hα2,0fragmentsHfragmentsα2,0H_{\alpha_{2},0}Hα2,1fragmentsHfragmentsα2,1H_{\alpha_{2},1}00Hα1,0fragmentsHfragmentsα1,0H_{\alpha_{1},0}Hα1,1fragmentsHfragmentsα1,1H_{\alpha_{1},1}Hα~,0fragmentsHfragments~𝛼,0H_{\widetilde{\alpha},0}Hα~,1fragmentsHfragments~𝛼,1H_{\widetilde{\alpha},1}q𝑞qα1fragmentsα1\alpha_{1}α2fragmentsα2\alpha_{2}α~~𝛼\widetilde{\alpha}IIIIIIIVVVI012122012102012011b𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle bc𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle bq𝑞\scriptscriptstyle qa𝑎\scriptscriptstyle aa𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle aE𝐸\scriptstyle EEfragmentsE\scriptstyle E^{\prime}w𝑤we𝑒ew3fragmentsw3w_{3}w4fragmentsw4w_{4}w5fragmentsw5w_{5}w=w0fragmentsww0w=w_{0}w1fragmentsw1w_{1}w2fragmentsw2w_{2}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}w0=wfragmentsw0ww_{0}=ww1fragmentsw1w_{1}w5fragmentsw5w_{5}w4fragmentsw4w_{4}w3fragmentsw3w_{3}w2fragmentsw2w_{2}w𝑤wwfragmentsww^{\prime}s𝑠\scriptstyle sy𝑦yz=yfragmentszyz=y^{\prime}zfragmentszz^{\prime}
Figure 6. Relation between hexagons for w𝑤w (Type 1) and w=ws>wfragmentswwsww^{\prime}=ws>w

Case 1: Suppose there is a unique simple reflection s𝑠s such that w:=ws>wfragmentswassignwsww^{\prime}:=ws>w. Then each vertex of wfragmentsH𝑤\mathcal{H}_{w} has the same property (for the same s𝑠s!), and the vertices of wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}} are given by wi=wis, 0i5fragmentsw𝑖w𝑖s, 0i5w^{\prime}_{i}=w_{i}s,\ 0\leq i\leq 5. Moreover, the alcoves AfragmentsAA^{\prime} whose centers lie along an edge of wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}} are precisely the alcoves A𝐴A whose centers lie along the edges of wfragmentsH𝑤\mathcal{H}_{w}, reflected across their s𝑠s edges. See Figure 6, where the red edges are all labeled by s𝑠s, and one of the six spiral half-strips is shaded grey.

Recall the spiral elements y𝑦y and z𝑧z, on and just outside the boundary of wfragmentsH𝑤\mathcal{H}_{w}. Then y=z=ysfragmentsyzysy^{\prime}=z=ys is the spiral element on the boundary of wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}}, and z=ztfragmentszztz^{\prime}=zt (for one of the simple reflections tsfragmentstst\neq s) is the spiral element just outside wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}}. Clearly yfragmentsyy^{\prime} is a subexpression of wfragmentsww^{\prime}, but the leftmost (and, indeed, every) such subexpression must use the final s𝑠s of w=wsfragmentswwsw^{\prime}=ws, else yfragmentsyy^{\prime} would be a subexpression of w𝑤w. And clearly zfragmentszz^{\prime} is not a subexpression of wfragmentsww^{\prime} since there is no factor t𝑡t beyond the final s𝑠s of wfragmentsww^{\prime} and its subexpression yfragmentsyy^{\prime}.

Hα2,0fragmentsHfragmentsα2,0H_{\alpha_{2},0}Hα2,1fragmentsHfragmentsα2,1H_{\alpha_{2},1}00Hα1,0fragmentsHfragmentsα1,0H_{\alpha_{1},0}Hα1,1fragmentsHfragmentsα1,1H_{\alpha_{1},1}Hα~,0fragmentsHfragments~𝛼,0H_{\widetilde{\alpha},0}Hα~,1fragmentsHfragments~𝛼,1H_{\widetilde{\alpha},1}q𝑞qα1fragmentsα1\alpha_{1}α2fragmentsα2\alpha_{2}α~~𝛼\widetilde{\alpha}IIIIIIIVVVI012122012102012011b𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle bc𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle bq𝑞\scriptscriptstyle qa𝑎\scriptscriptstyle aa𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle aE𝐸\scriptstyle EEfragmentsE\scriptstyle E^{\prime}w𝑤we𝑒ew3fragmentsw3w_{3}w4fragmentsw4w_{4}w5fragmentsw5w_{5}w=w0fragmentsww0w=w_{0}w1fragmentsw1w_{1}w2fragmentsw2w_{2}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}w0=wfragmentsw0ww_{0}=ww1fragmentsw1w_{1}w5fragmentsw5w_{5}w4fragmentsw4w_{4}w3fragmentsw3w_{3}w2fragmentsw2w_{2}w𝑤wwfragmentsww^{\prime}s𝑠\scriptstyle sy𝑦yz=yfragmentszyz=y^{\prime}zfragmentszz^{\prime}w𝑤wwfragmentsww^{\prime}y=yfragmentsyyy=y^{\prime}z=zfragmentszzz=z^{\prime}s𝑠\scriptstyle s
Figure 7. Relation between hexagons for w𝑤w (Type 2) and w=ws>wfragmentswwsww^{\prime}=ws>w

Case 2: Suppose there are two simple reflections s𝑠s for which ws>wfragmentswswws>w. Fix one of them, and set w:=wsfragmentswassignwsw^{\prime}:=ws. Each of three non-intersecting edges of wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}} contains an edge of wfragmentsH𝑤\mathcal{H}_{w}; the remaining three edges of wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}} are one root string outside the parallel edges of wfragmentsH𝑤\mathcal{H}_{w}. (See Figure 7, where the red edges are all labeled by s𝑠s, and one of the six spiral half-strips is shaded grey.) The alcoves along an edge of wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}} which “moved out” are obtained by reflecting across their s𝑠s edges the alcoves along the adjacent parallel edge of wfragmentsH𝑤\mathcal{H}_{w}, as in Case 1. For the spiral elements along these three edges, the analysis is exactly the same as before.

Reflection in the s𝑠s edge stabilizes the set of alcoves on the remaining three edges of wfragmentsH𝑤\mathcal{H}_{w} (and on the collinear edges of wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}}). For the spiral element y𝑦y on one of these edges of wfragmentsH𝑤\mathcal{H}_{w}, y=yfragmentsyyy^{\prime}=y and z=z=ytfragmentszzytz^{\prime}=z=yt for some simple reflection tsfragmentstst\neq s. Of course y=yw<wfragmentsyywwy^{\prime}=y\leq w<w^{\prime} by the induction hypothesis. And since y𝑦y is a subexpression of w𝑤w but z=ytfragmentszytz=yt is not, z=ytfragmentszytz^{\prime}=yt could only be a subexpression of w=wsfragmentswwsw^{\prime}=ws if t=sfragmentstst=s, which is not the case. ∎

5. The translation move

We will study the integers qwxfragmentsq𝑤𝑥q^{w}_{x} for xwfragmentsxwx\leq w using the following strategy. The operation of translation into the chamber introduced in Section 3 gives us a “Translation Move”. The main result of this section is that if w𝑤w is obtained from wfragmentsww^{\prime} by the Translation Move, and x𝑥x is not in an outer shell of wfragmentsH𝑤\mathcal{H}_{w}, then qwx=qwx+2fragmentsq𝑤𝑥qfragmentsw𝑥2q^{w}_{x}=q^{w^{\prime}}_{x}+2 (see Theorem 5.1). In Section 6, we describe qwxfragmentsq𝑤𝑥q^{w}_{x} if x𝑥x is on an outer shell of wfragmentsH𝑤\mathcal{H}_{w}. In Section 7, we describe qwxfragmentsq𝑤𝑥q^{w}_{x} if w𝑤w is a “base case”, that is, a non-spiral element which is not obtained by a translation move. The results of Sections 5, 6, and 7 together yield a description of qwxfragmentsq𝑤𝑥q^{w}_{x} for any non-spiral element w𝑤w.

5.1. Hexagon shells

We call the union of the (generically, six) edges of wfragmentsH𝑤\mathcal{H}_{w} its 0-shell. These edges lie on certain root strings, and the hexagon together with its interior consists of the intersection of the closed half-spaces containing q𝑞q determined by these six root strings. Now consider the root strings passing through the interior of the hexagon and one string in from an edge (the “reference edge”). The intersection of the half-spaces on the side of these root strings not containing the reference edge is a convex region inside the hexagon, whose boundary (consisting of intervals lying along some or all of those root strings) we call the 1-shell of wfragmentsH𝑤\mathcal{H}_{w}. Repeating this process we obtain the 2-shell, and so on. Figure 8 shows the 0-, 1-, 2-, and 3-shells of a typical hexagon wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}}. See also Figure 15 for a situation where wfragmentsH𝑤\mathcal{H}_{w} has some very short edges.

5.2. Translations

Recall from Section 3 that for each chamber 𝒞𝒞\mathcal{C}, there is a unique root αΦfragmentsαΦ\alpha\in\Phi pointing into 𝒞𝒞\mathcal{C}. Moreover, given a non-spiral w𝑤w, there is an operation “translation into the chamber” which takes w𝑤w to w=t(α)wfragmentswt(α)ww^{\prime}=t(\alpha)w, where α𝛼\alpha is the root pointing into the chamber containing w𝑤w.

Hα2,0fragmentsHfragmentsα2,0H_{\alpha_{2},0}Hα2,1fragmentsHfragmentsα2,1H_{\alpha_{2},1}00Hα1,0fragmentsHfragmentsα1,0H_{\alpha_{1},0}Hα1,1fragmentsHfragmentsα1,1H_{\alpha_{1},1}Hα~,0fragmentsHfragments~𝛼,0H_{\widetilde{\alpha},0}Hα~,1fragmentsHfragments~𝛼,1H_{\widetilde{\alpha},1}q𝑞qα1fragmentsα1\alpha_{1}α2fragmentsα2\alpha_{2}α~~𝛼\widetilde{\alpha}IIIIIIIVVVI012122012102012011b𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle bc𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle bq𝑞\scriptscriptstyle qa𝑎\scriptscriptstyle aa𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle aE𝐸\scriptstyle EEfragmentsE\scriptstyle E^{\prime}w𝑤we𝑒ew3fragmentsw3w_{3}w4fragmentsw4w_{4}w5fragmentsw5w_{5}w=w0fragmentsww0w=w_{0}w1fragmentsw1w_{1}w2fragmentsw2w_{2}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}w0=wfragmentsw0ww_{0}=ww1fragmentsw1w_{1}w5fragmentsw5w_{5}w4fragmentsw4w_{4}w3fragmentsw3w_{3}w2fragmentsw2w_{2}w𝑤wwfragmentsww^{\prime}s𝑠\scriptstyle sy𝑦yz=yfragmentszyz=y^{\prime}zfragmentszz^{\prime}w𝑤wwfragmentsww^{\prime}y=yfragmentsyyy=y^{\prime}z=zfragmentszzz=z^{\prime}s𝑠\scriptstyle swfragmentsww^{\prime}w𝑤w
Figure 8. Translation and outer shells
Theorem 5.1.

Suppose w𝑤w is a non-spiral element of W𝑊W. Let wfragmentsww^{\prime} be the element obtained by translating w𝑤w into the chamber. If xwfragmentsxwx\leq w, then qxw=qxw+2fragmentsq𝑥fragmentswq𝑥𝑤2q_{x}^{w^{\prime}}=q_{x}^{w}+2.

Proof.

By Proposition 3.6, w>wfragmentswww^{\prime}>w, and (w)=(w)+4fragments(w)(w)4\ell(w^{\prime})=\ell(w)+4. Let w=w0,,w5fragmentsww0,,w5w=w_{0},\ldots,w_{5} (resp. w=w0,,w5fragmentsww0,,w5w^{\prime}=w^{\prime}_{0},\ldots,w^{\prime}_{5} be the vertices of wfragmentsH𝑤\mathcal{H}_{w} (resp. wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}}), numbered as Section 4. Let 𝒞0,,𝒞5fragmentsC0,,C5\mathcal{C}_{0},\ldots,\mathcal{C}_{5} be the chambers, numbered counterclockwise, with w0𝒞0fragmentsw0C0w_{0}\in\mathcal{C}_{0}. (If wifragmentsw𝑖w_{i} is not spiral, then wifragmentsw𝑖w_{i} lies in 𝒞ifragmentsC𝑖\mathcal{C}_{i}.) Let γifragmentsγ𝑖\gamma_{i} be the root pointing into 𝒞ifragmentsC𝑖\mathcal{C}_{i}. From the formulas for wifragmentsw𝑖w_{i} and wifragmentsw𝑖w^{\prime}_{i}, we see that wi=t(γi)wifragmentsw𝑖t(γ𝑖)w𝑖w^{\prime}_{i}=t(\gamma_{i})w_{i}.

Let αΦfragmentsαΦ\alpha\in\Phi, and let L𝐿L be an α𝛼\alpha-root string which intersects wfragmentsH𝑤\mathcal{H}_{w}. Let p𝑝p and pfragmentspp^{\prime} be the extreme points of LwfragmentsLH𝑤L\cap\mathcal{H}_{w}, labelled so that ppfragmentsppp-p^{\prime} is a positive multiple of α𝛼\alpha. Then we claim that the extreme points of LwfragmentsLHfragmentswL\cap\mathcal{H}_{w^{\prime}} are p+αfragmentspαp+\alpha and pαfragmentspαp^{\prime}-\alpha. Indeed, suppose p𝑝p lies on the edge E=wi1wifragmentsEwfragmentsi1w𝑖E=w_{i-1}w_{i} of wfragmentsH𝑤\mathcal{H}_{w}, where subscripts are interpreted mod 6. (If p𝑝p happens to be a vertex of wfragmentsH𝑤\mathcal{H}_{w}, choose E𝐸E so that it is not parallel to α𝛼\alpha.) Suppose α=γifragmentsαγ𝑖\alpha=\gamma_{i}. Note that wi+α=wifragmentsw𝑖αw𝑖w_{i}+\alpha=w^{\prime}_{i}, an endpoint of the edge E=wi1wifragmentsEwfragmentsi1w𝑖E^{\prime}=w^{\prime}_{i-1}w^{\prime}_{i} of wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}}, and E𝐸E and EfragmentsEE^{\prime} are parallel, with EfragmentsEE^{\prime} longer. It follows by elementary geometry that for any point, such as p𝑝p, on E𝐸E, the point p+αfragmentspαp+\alpha lies on EfragmentsEE^{\prime}. The proof is similar if α=γi1fragmentsαγfragmentsi1\alpha=\gamma_{i-1} using the other endpoints of E𝐸E and EfragmentsEE^{\prime}. The third option, α=±γi+1fragmentsαplus-or-minusγfragmentsi1\alpha=\pm\gamma_{i+1}, is not actually a possibility because γi+1fragmentsγfragmentsi1\gamma_{i+1} is parallel to the edge E𝐸E, and we chose E𝐸E to exclude this situation. The proof for pfragmentspp^{\prime} is analogous. This proves the claim.

We claim that each of the intervals (i.e., half-open line segments) (p,p+α]fragments(p,pα](p,p+\alpha] and (p,pα]fragments(p,pα](p^{\prime},p^{\prime}-\alpha] contains two alcove centers, one of each orientation. Indeed, consider the interval (p,p+α]fragments(p,pα](p,p+\alpha], the argument for (p,pα]fragments(p,pα](p^{\prime},p^{\prime}-\alpha] being similar. Then either p𝑝p is the center of an Up alcove, the center of a Down alcove, or an alcove vertex. By symmetry, it suffices to check the claim for a single point p𝑝p for each of these 333 possibilities, and this can be done by inspection.

Given xwfragmentsxwx\leq w, there are 333 root strings passing through x𝑥x, each of which intersects wfragmentsH𝑤\mathcal{H}_{w}. If L𝐿L is such a root string, the preceding paragraph implies that the alcove centers on LwfragmentsLHfragmentswL\cap\mathcal{H}_{w^{\prime}} are the alcove centers on LwfragmentsLH𝑤L\cap\mathcal{H}_{w}, together with 444 additional alcoves, 222 of each orientation. Therefore, there are 666 additional reflections (222 for each L𝐿L) which, when applied to x𝑥x, stay in the hexagon wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}} (as compared to the hexagon wfragmentsH𝑤\mathcal{H}_{w}). But (w)(w)=4fragments(w)(w)4\ell(w)-\ell(w^{\prime})=-4 by Proposition 3.6, so qwx=qwx+2fragmentsqfragmentsw𝑥q𝑤𝑥2q^{w^{\prime}}_{x}=q^{w}_{x}+2, as desired. ∎

Corollary 5.2.

Let wfragmentsww^{\prime} be a non-spiral element of W𝑊W, and assume wfragmentsww^{\prime} is not a base case.

(a) For all x𝑥x on or inside the 3-shell of wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}}, qwx2fragmentsqfragmentsw𝑥2q^{w^{\prime}}_{x}\geq 2.

(b) If wfragmentsww^{\prime} is of Type 2, then for all x𝑥x on the 2-shell of wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}}, qwx1fragmentsqfragmentsw𝑥1q^{w^{\prime}}_{x}\geq 1.

In particular, the only xwfragmentsxwx\leq w^{\prime} for which qwx=0fragmentsqfragmentsw𝑥0q^{w^{\prime}}_{x}=0 are on the 0-, 1-, or 2-shell, and are explicitly described in Theorem 6.1.

Proof.

Any wfragmentsww^{\prime} as in the statement of the corollary is the translation into the chamber of some w𝑤w in the chamber, as in Theorem 5.1. Moreover the boundary of wfragmentsH𝑤\mathcal{H}_{w} is the 3-shell of wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}}. So part (a) of the corollary follows immediately from the last statement of the theorem, along with the fact that qwx0fragmentsq𝑤𝑥0q^{w}_{x}\geq 0 for all xwfragmentsxwx\leq w. Part (b) follows from Theorem 6.1 (c) and (d), below. ∎

Remark 5.3.

This corollary implies that if a non-spiral XwfragmentsX𝑤X_{w} is rationally smooth, then w𝑤w is necessarily a base case. The analysis of the base cases in Section 7 then allows us to determine the rationally smooth Schubert varieties in type A~2fragments~𝐴2\widetilde{A}_{2} (Corollary 7.1).

Figure 8 illustrates the translation move in Chamber I. Rays along the red and green lines give the walls of the chamber containing w𝑤w and wfragmentsww^{\prime}, and the blue line is the third hyperplane used to obtain the hexagons wfragmentsH𝑤\mathcal{H}_{w} and wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}}.

Hα2,0fragmentsHfragmentsα2,0H_{\alpha_{2},0}Hα2,1fragmentsHfragmentsα2,1H_{\alpha_{2},1}00Hα1,0fragmentsHfragmentsα1,0H_{\alpha_{1},0}Hα1,1fragmentsHfragmentsα1,1H_{\alpha_{1},1}Hα~,0fragmentsHfragments~𝛼,0H_{\widetilde{\alpha},0}Hα~,1fragmentsHfragments~𝛼,1H_{\widetilde{\alpha},1}q𝑞qα1fragmentsα1\alpha_{1}α2fragmentsα2\alpha_{2}α~~𝛼\widetilde{\alpha}IIIIIIIVVVI012122012102012011b𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle bc𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle bq𝑞\scriptscriptstyle qa𝑎\scriptscriptstyle aa𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle aE𝐸\scriptstyle EEfragmentsE\scriptstyle E^{\prime}w𝑤we𝑒ew3fragmentsw3w_{3}w4fragmentsw4w_{4}w5fragmentsw5w_{5}w=w0fragmentsww0w=w_{0}w1fragmentsw1w_{1}w2fragmentsw2w_{2}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}w0=wfragmentsw0ww_{0}=ww1fragmentsw1w_{1}w5fragmentsw5w_{5}w4fragmentsw4w_{4}w3fragmentsw3w_{3}w2fragmentsw2w_{2}w𝑤wwfragmentsww^{\prime}s𝑠\scriptstyle sy𝑦yz=yfragmentszyz=y^{\prime}zfragmentszz^{\prime}w𝑤wwfragmentsww^{\prime}y=yfragmentsyyy=y^{\prime}z=zfragmentszzz=z^{\prime}s𝑠\scriptstyle swfragmentsww^{\prime}w𝑤ww𝑤w
Figure 9. Shell behavior of q𝑞q

Following the strategy outlined at the beginning of this section, we can describe qwxfragmentsq𝑤𝑥q^{w}_{x} in a fairly explicit way for any non-spiral w𝑤w. In any chamber 𝒞𝒞\mathcal{C}, there are two types of base cases: the alcoves which share an edge with a fundamental strip, or the alcoves which share a vertex with a fundamental strip. So there are essentially four types of base cases in total: two for odd chambers, and two for even chambers. Any w𝑤w in 𝒞𝒞\mathcal{C} is either a base case, or is obtained from a base case by a sequence of translations by the root α𝛼\alpha pointing into 𝒞𝒞\mathcal{C}. Therefore we can proceed as follows. First, if w𝑤w is a base case, we will describe (in Section 7) qwxfragmentsq𝑤𝑥q^{w}_{x} for all xwfragmentsxwx\leq w. Second, if w𝒞fragmentswCw^{\prime}\in\mathcal{C} and w=t(α)wfragmentswt(α)ww^{\prime}=t(\alpha)w, then for xwfragmentsxwx\leq w, we can assume qwxfragmentsq𝑤𝑥q^{w}_{x} is known by induction. Therefore, for xwfragmentsxwx\leq w^{\prime}, if x𝑥x is not on the 00-, 111-, or 222-shell of wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}}, then xwfragmentsxwx\leq w and qwx=qwx+2fragmentsqfragmentsw𝑥q𝑤𝑥2q^{w^{\prime}}_{x}=q^{w}_{x}+2. To complete the picture, we will describe qwxfragmentsqfragmentsw𝑥q^{w^{\prime}}_{x} for x𝑥x on the 00-, 111-, or 222-shell of wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}} (in Section 6).

Figure 9 shows the behavior of q𝑞q for the simplest situation: w𝑤w is of Type 1 in an even chamber. This means w𝑤w is obtained by translation from Base Case I. The values of q𝑞q are constant on the orbits xR(w)fragmentsxR(w)xR(w), which are small W(A2)fragmentsW(A2)W(A_{2})-hexagons: yellow 0, green 2, orange 4, and blue 6. More generally, q𝑞q is constant equal to 2kfragments2k2k on the shells numbered 3k,3k+1,3k+2fragments3k,3k1,3k23k,3k+1,3k+2 for k=0,1,fragmentsk0,1,k=0,1,\dots, except that q𝑞q remains constant once the W(A2)fragmentsW(A2)W(A_{2})-hexagon of x𝑥x meets the triangle formed by the hexagon diagonals. If w𝑤w is of Type 2 in an even chamber, w𝑤w is obtained by translation from Base Case 2. Here, the orbits xR(w)fragmentsxR(w)xR(w) are small W(A1)fragmentsW(A1)W(A_{1})-diamonds, and the value of q𝑞q is constant on these orbits. More precisely, q𝑞q has value equal to 2kfragments2k2k on shells numbered 3kfragments3k3k and 3k+1fragments3k13k+1, and has value 2k+1fragments2k12k+1 on shells numbered 3k+2fragments3k23k+2, for k=0,1,fragmentsk0,1,k=0,1,\dots, until q𝑞q remains constant once x𝑥x meets the triangle formed by the hexagon diagonals. For w𝑤w in an odd chamber, the behavior of q𝑞q is more complicated. Figures 12 and 13 illustrate the two base cases for w𝑤w in an odd chamber.

6. Values of q𝑞q on outer hexagon shells

In this section, we fix wWfragmentswWw\in W and compute explicitly the values qxwfragmentsq𝑥𝑤q_{x}^{w} for x𝑥x on or near the boundary of the hexagon wfragmentsH𝑤\mathcal{H}_{w}. This will handle the new elements x𝑥x arising in the Translation Move. More precisely, our goal here is to compute qwxfragmentsq𝑤𝑥q^{w}_{x} for x𝑥x on the 0-, 1-, or 2-shell of wfragmentsH𝑤\mathcal{H}_{w}.

We begin with some observations which will be used in the proof of the main result of this section, Theorem 6.1. Assume w𝑤w is non-spiral of Type 1, with w<ws=:wfragmentswws:ww<ws=:w^{\prime} for a (unique) simple reflection s𝑠s. Then the vector from w𝑤w to wfragmentsww^{\prime} is a positive multiple of α𝛼\alpha, the root which points into the chamber containing w𝑤w (see Lemma 3.5). The root hyperplanes used to construct the vertices of wfragmentsH𝑤\mathcal{H}_{w} and wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}} are identical. Therefore these two hexagons are concentric and one root string apart along each edge. Moreover, by Lemma 3.8 there is a bijection between alcoves x𝑥x along the edge of wfragmentsH𝑤\mathcal{H}_{w} and alcoves x:=xsfragmentsxassignxsx^{\prime}:=xs along the edge of wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}}, as shown in Figure 6, where the red edges all correspond to s𝑠s.

Theorem 6.1.

Fix wWfragmentswWw\in W a non-spiral element and assume xwfragmentsxwx\leq w lies on the 0-, 1- or 2-shell of wfragmentsH𝑤\mathcal{H}_{w}.

(a) If w𝑤w is of Type 1 in an even chamber, then qwx=0fragmentsq𝑤𝑥0q^{w}_{x}=0.

(b) If w𝑤w is of Type 1 in an odd chamber, then qwx=1fragmentsq𝑤𝑥1q^{w}_{x}=1 if xR(w)fragmentsxR(w)xR(w) intersects a special segment of wfragmentsH𝑤\mathcal{H}_{w}; otherwise qwx=0fragmentsq𝑤𝑥0q^{w}_{x}=0.

(c) If w𝑤w is of Type 2 in an even chamber, then qwx=0fragmentsq𝑤𝑥0q^{w}_{x}=0 if x𝑥x belongs to the 0- or 1-shell of wfragmentsH𝑤\mathcal{H}_{w}; otherwise qwx=1fragmentsq𝑤𝑥1q^{w}_{x}=1.

(d) Assume w𝑤w is of Type 2 in an odd chamber. First suppose x𝑥x belongs to the 0- or 1-shell. Then qwx=1fragmentsq𝑤𝑥1q^{w}_{x}=1 if xR(w)fragmentsxR(w)xR(w) intersects a special segment; otherwise qwx=0fragmentsq𝑤𝑥0q^{w}_{x}=0. Next suppose x𝑥x belongs to the 2-shell. If x𝑥x belongs to a 2-shell edge which is parallel to and two root strings in from a special edge of wfragmentsH𝑤\mathcal{H}_{w}, then qwx=2fragmentsq𝑤𝑥2q^{w}_{x}=2; otherwise qwx=1fragmentsq𝑤𝑥1q^{w}_{x}=1.

As hinted in the proof of Theorem 4.1, we will use an inductive argument involving reflection across alcove walls. More precisely, we will assume the result for a Type 1 element w𝑤w (such as the lowest alcove in each chamber), and prove it for w:=ws>wfragmentswassignwsww^{\prime}:=ws>w (“Move 1”). Now wfragmentsww^{\prime} is of Type 2, and we will do another inductive step to prove the result for w:=wt>wfragmentswfragmentsassignwtww^{\prime\prime}:=w^{\prime}t>w^{\prime} (“Move 2”). Here s𝑠s and t𝑡t are distinct simple reflections. This completes the cycle since wfragmentswfragmentsw^{\prime\prime} is again of Type 1. An important point is that we can reach any non-spiral element (except for the minimal element in each chamber) by a sequence of Moves 1 and 2 within a single chamber.

In order to keep track of the change in q𝑞q during each Move, we will introduce root-string-based integer coordinates for the alcoves in wfragmentsH𝑤\mathcal{H}_{w} (where we are now assuming w𝑤w is of Type 1). See Figures 10 and 11. The α0fragmentsα0\alpha_{0} strings in the hexagon will be labeled according to where they intersect the W or SW edges of the hexagon. First, label the alcoves whose centers lie on these edges, with label 0 at the SW vertex and increasing counterclockwise, resulting in positive labels along the SW edge and negative along the W edge. (For compactness of notation, we denote odd labels by a bar above instead of a negative sign in front.) So far we have labels for roughly 2/3 of the α0fragmentsα0\alpha_{0} strings, but there are also strings which intersect the edge not at an alcove center but at an alcove vertex. We label these strings by using the label of the adjacent odd-numbered string, decorated with a * superscript. So the sequence of labels moving counterclockwise through the vertex will be ,2¯,1¯,1¯,0,1,1,2,3,3,fragments,¯2,¯1,¯1,0,1,1,2,3,3,\dots,\overline{2},\overline{1}^{*},\overline{1},0,1,1^{*},2,3,3^{*},\dots.

The α1fragmentsα1\alpha_{1} strings are labeled according to their intersection with the SE or E edges, with 0 at the SE vertex, increasing counterclockwise for the alcove centers along the edge, and with additional odd* labels for the strings which interesect the edge in alcove vertices. And the α2fragmentsα2\alpha_{2} strings are labeled similarly by their intersection with the NE and NW edges, with 0 at the N vertex and increasing counterclockwise. Finally, each alcove x𝑥x in the hexagon wfragmentsH𝑤\mathcal{H}_{w} is labeled (i0,i1,i2)fragments(i0,i1,i2)(i_{0},i_{1},i_{2}) where ijfragmentsi𝑗i_{j} is the label on the αjfragmentsα𝑗\alpha_{j} string passing through x𝑥x, for j=0,1,2fragmentsj0,1,2j=0,1,2. We will refer to each coordinate ijfragmentsi𝑗i_{j} as either even, odd, or odd*; in particular “odd” implicitly means “without a *”.

Proof.

We give the proof (mainly) for the Up alcoves. The proof for the Down alcoves is similar, and the details will mostly be left to the reader.

Move 1: Fix w𝑤w of Type 1, with w<ws=:wfragmentswws:ww<ws=:w^{\prime}, and assume the result is true for w𝑤w. Note that R(w)=sfragmentsR(w)sR(w^{\prime})=\langle s\rangle.

Assume xwfragmentsxwx\leq w is an Up alcove having coordinates (i0,i1,i2)fragments(i0,i1,i2)(i_{0},i_{1},i_{2}). Recall that qxwfragmentsq𝑥𝑤q_{x}^{w} counts the total number of reflections r𝑟r such that rxwfragmentsrxwrx\leq w, minus (w)fragments(w)\ell(w). The reflections r𝑟r have the form sα,kfragmentssfragmentsα,ks_{\alpha,k} for α{α1,α2,α~}fragmentsα{α1,α2,~𝛼}\alpha\in\{\alpha_{1},\alpha_{2},\widetilde{\alpha}\}, and kfragmentskZk\in\mathbb{Z}. For a fixed such α𝛼\alpha, the reflections sα,kfragmentssfragmentsα,ks_{\alpha,k} contributing to qxwfragmentsq𝑥𝑤q_{x}^{w} are in bijection with the Down alcoves inside wfragmentsH𝑤\mathcal{H}_{w} on the α𝛼\alpha string through x𝑥x. As described in the paragraph before Theorem 6.1, the hexagon wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}} is obtained from wfragmentsH𝑤\mathcal{H}_{w} by moving every edge out to the next adjacent root string. Thus the reflections of type α𝛼\alpha contributing to qxwfragmentsq𝑥fragmentswq_{x}^{w^{\prime}} correspond to the same Down alcoves as for w𝑤w, plus any additional Down alcoves at the ends of the α𝛼\alpha string through x𝑥x in wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}}. It is easy to see that there is one such additional Down alcove when the coordinate ijfragmentsi𝑗i_{j} is either even or odd*, and none when the coordinate is odd. Therefore the change in qxfragmentsq𝑥q_{x}^{\bullet} for Move 1 from w𝑤w to wfragmentsww^{\prime} is

Δq1:=qxwqxw=j=02(δij,e+δij,)1,fragmentsΔq1assignq𝑥fragmentswq𝑥𝑤fragmentsj02(δfragmentsi𝑗,eδfragmentsi𝑗,)1,\Delta q_{1}:=q_{x}^{w^{\prime}}-q_{x}^{w}=\sum_{j=0}^{2}(\delta_{i_{j},e}+\delta_{i_{j},*})-1, (6.1)

where δij,efragmentsδfragmentsi𝑗,e\delta_{i_{j},e} (resp. δij,ofragmentsδfragmentsi𝑗,o\delta_{i_{j},o}, δij,)fragmentsδfragmentsi𝑗,)\delta_{i_{j},*}) is 1 if ijfragmentsi𝑗i_{j} is even (resp. odd, odd*), and 0 otherwise. The “1fragments1-1” is present because (w)=(w)+1fragments(w)(w)1\ell(w^{\prime})=\ell(w)+1. In words, Δq1fragmentsΔq1\Delta q_{1} for an Up alcove is one less than the number of even entries plus the number of odd* entries among the coordinates of x𝑥x.

A similar analysis for Down alcoves yields almost the same formula. However, when w𝑤w is in an odd chamber, there are two pairs of root strings lying between parallel diagonals of the hexagon. These are the strings in Figure 11 labeled i1=1¯,1¯fragmentsi1¯1,¯1i_{1}=\overline{1}^{*},\overline{1} or i2=1,1fragmentsi21,1i_{2}=1,1^{*}. On these 4 strings, the roles of odd and odd* are reversed. The upshot is that Δq1fragmentsΔq1\Delta q_{1} for a Down alcove is one less than the number of even entries, plus the number of odd* entries not between two parallel diagonals, plus the number of odd entries between two parallel diagonals. We sometimes refer to as “unusual” these odd entries which contribute to Δq1fragmentsΔq1\Delta q_{1}.

Continue to assume x𝑥x is an Up alcove. Suppose now that x𝑥x lies on a boundary edge E𝐸E of wfragmentsH𝑤\mathcal{H}_{w}; i.e., on the 1-shell of wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}}. Since the end alcoves of any hexagon edge are related by a reflection through a line which passes through an edge or a vertex (but not the center) of an alcove along the edge, the number of alcoves on the edge is even. Since one end alcove is labeled 0, the other end alcove has an odd label. It follows that the coordinate which is constant along E𝐸E is odd. The coordinate for an Up alcove along E𝐸E is always odd, because the alcoves labeled 0—the N, SE, and SW corners of wfragmentsH𝑤\mathcal{H}_{w}—are always Down for w𝑤w of Type 1. Finally, the remaining coordinate of an Up alcove on E𝐸E is always even. Therefore the coordinates of x𝑥x are some permutation of (o,o,e)fragments(o,o,e)(o,o,e), and it follows from (6.1) that Δq1=0fragmentsΔq10\Delta q_{1}=0; i.e., qxw=qxwfragmentsq𝑥fragmentswq𝑥𝑤q_{x}^{w^{\prime}}=q_{x}^{w}. We leave it to the reader to check that the same formula is true for the Down alcoves on E𝐸E.

By the induction hypothesis, qxw=0fragmentsq𝑥𝑤0q_{x}^{w}=0, unless x𝑥x lies on a special segment of E𝐸E, in which case qxw=1fragmentsq𝑥𝑤1q_{x}^{w}=1. Recall from the paragraph before Theorem 6.1 that each alcove xfragmentsxx^{\prime} of the corresponding edge EfragmentsEE^{\prime} of wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}} is of the form x=xs>xfragmentsxxsxx^{\prime}=xs>x for an x𝑥x on E𝐸E. By the Simple Move (Proposition 2.1), since w>wsfragmentswwsw^{\prime}>w^{\prime}s, qxw=qxwfragmentsqfragmentsxfragmentswq𝑥fragmentswq_{x^{\prime}}^{w^{\prime}}=q_{x}^{w^{\prime}}. Moreover, since the diagonals which determine the special segments for wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}} and wfragmentsH𝑤\mathcal{H}_{w} are collinear, xfragmentsxx^{\prime} is on a special segment of EfragmentsEE^{\prime} if and only if x𝑥x is on a special segment of E𝐸E. Combining the formulas qxw=qxwfragmentsqfragmentsxfragmentswq𝑥fragmentswq_{x^{\prime}}^{w^{\prime}}=q_{x}^{w^{\prime}} and qxw=qxwfragmentsq𝑥fragmentswq𝑥𝑤q_{x}^{w^{\prime}}=q_{x}^{w} thus gives the desired values of q𝑞q on the 0- and 1-shells for wfragmentsww^{\prime}.

It remains to compute qxwfragmentsq𝑥fragmentswq_{x}^{w^{\prime}} for x𝑥x on the 2-shell of wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}}; i.e., x𝑥x is on some edge E𝐸E of the 1-shell of wfragmentsH𝑤\mathcal{H}_{w}.

First, assume x𝑥x does not lie between two parallel diagonals of wfragmentsH𝑤\mathcal{H}_{w}. By a similar analysis as before, the coordinates of x𝑥x are some permutation of (e,o,o)fragments(e,o,o)(e,o,o^{*}), so Δq=1+11=1fragmentsΔq1111\Delta q=1+1-1=1. If x𝑥x is not (resp. is) a reflection across one of its alcove walls from a special segment alcove of wfragmentsH𝑤\mathcal{H}_{w}, we have qwx=0fragmentsq𝑤𝑥0q^{w}_{x}=0 (resp. 111), and thus qwx=1fragmentsqfragmentsw𝑥1q^{w^{\prime}}_{x}=1 (resp. 222).

Finally, assume x𝑥x does lie between two parallel diagonals of wfragmentsH𝑤\mathcal{H}_{w}. Such alcoves occur in pairs forming a “diamond” at one end or the other of E𝐸E (and E𝐸E must be one root string in from and parallel to a special edge of wfragmentsH𝑤\mathcal{H}_{w}). Assuming E𝐸E has length at least 4, there will be two such diamonds on E𝐸E. The outer (end) alcoves x𝑥x have qwx=0fragmentsq𝑤𝑥0q^{w}_{x}=0. The outer Up alcove has coordinates (some permutation of) (e,o,o)fragments(e,o,o)(e,o^{*},o^{*}), so Δq=1+1+11=2fragmentsΔq11112\Delta q=1+1+1-1=2, whence qwx=0+2=2fragmentsqfragmentsw𝑥022q^{w^{\prime}}_{x}=0+2=2. The outer Down alcove has coordinates (some permutation of) (e,o,o)fragments(e,o,o)(e,o^{*},o), but the “o𝑜o” is unusual (counts towards ΔqfragmentsΔq\Delta q) because x𝑥x is a Down alcove between parallel diagonals. So again Δq=2fragmentsΔq2\Delta q=2 and qwx=2fragmentsqfragmentsw𝑥2q^{w^{\prime}}_{x}=2. The inner (next-to-the-end) diamond alcoves x𝑥x have qwx=1fragmentsq𝑤𝑥1q^{w}_{x}=1 (because xR(w)fragmentsxR(w)xR(w) intersects a special segment). The Up alcove coordinates are (some permutation of) (e,o,o)fragments(e,o,o)(e,o,o^{*}), so Δq=1+11=1fragmentsΔq1111\Delta q=1+1-1=1, whence qwx=1+1=2fragmentsqfragmentsw𝑥112q^{w^{\prime}}_{x}=1+1=2. The Down alcove coordinates are (some permutation of) (e,o,o)fragments(e,o,o)(e,o,o), but one “o𝑜o” is unusual, and again qwx=1+1=2fragmentsqfragmentsw𝑥112q^{w^{\prime}}_{x}=1+1=2. Lastly, if E𝐸E has length 2, then there is just one diamond of alcoves between parallel diagonals, but they lie between both pairs of parallel diagonals. The adjacent special edge of wfragmentsH𝑤\mathcal{H}_{w} has empty special segment, so qwx=0fragmentsq𝑤𝑥0q^{w}_{x}=0. The Up alcove coordinates are (some permutation of) (e,o,o)fragments(e,o,o)(e,o^{*},o^{*}), so Δq=1+1+11=2fragmentsΔq11112\Delta q=1+1+1-1=2, and qwx=0+2=2fragmentsqfragmentsw𝑥022q^{w^{\prime}}_{x}=0+2=2. The Down alcove coordinates are (some permutation of) (e,o,o)fragments(e,o,o)(e,o,o), but both o𝑜o’s are unusual, so again Δq=2fragmentsΔq2\Delta q=2, and qwx=0+2=2fragmentsqfragmentsw𝑥022q^{w^{\prime}}_{x}=0+2=2.

This completes the verification of the values of q𝑞q for the Type 2 element wfragmentsww^{\prime} on its 0-, 1- and 2-shells.

Move 2: We assume the result for w𝑤w and w=wsfragmentswwsw^{\prime}=ws as above, and prove it for w:=wt>wfragmentswfragmentsassignwtww^{\prime\prime}:=w^{\prime}t>w^{\prime} for one of the two possible simple reflections t𝑡t. Because of the differing geometry of the hexagon in even and odd chambers, we must treat each case separately. We give the argument for a representative chamber of each parity; the result for the other chambers of the same parity follows similarly. Likewise we give the argument only for one of the two possible t𝑡t’s, the other following after the obvious adjustments.

Hα2,0fragmentsHfragmentsα2,0H_{\alpha_{2},0}Hα2,1fragmentsHfragmentsα2,1H_{\alpha_{2},1}00Hα1,0fragmentsHfragmentsα1,0H_{\alpha_{1},0}Hα1,1fragmentsHfragmentsα1,1H_{\alpha_{1},1}Hα~,0fragmentsHfragments~𝛼,0H_{\widetilde{\alpha},0}Hα~,1fragmentsHfragments~𝛼,1H_{\widetilde{\alpha},1}q𝑞qα1fragmentsα1\alpha_{1}α2fragmentsα2\alpha_{2}α~~𝛼\widetilde{\alpha}IIIIIIIVVVI012122012102012011b𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle bc𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle bq𝑞\scriptscriptstyle qa𝑎\scriptscriptstyle aa𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle aE𝐸\scriptstyle EEfragmentsE\scriptstyle E^{\prime}w𝑤we𝑒ew3fragmentsw3w_{3}w4fragmentsw4w_{4}w5fragmentsw5w_{5}w=w0fragmentsww0w=w_{0}w1fragmentsw1w_{1}w2fragmentsw2w_{2}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}w0=wfragmentsw0ww_{0}=ww1fragmentsw1w_{1}w5fragmentsw5w_{5}w4fragmentsw4w_{4}w3fragmentsw3w_{3}w2fragmentsw2w_{2}w𝑤wwfragmentsww^{\prime}s𝑠\scriptstyle sy𝑦yz=yfragmentszyz=y^{\prime}zfragmentszz^{\prime}w𝑤wwfragmentsww^{\prime}y=yfragmentsyyy=y^{\prime}z=zfragmentszzz=z^{\prime}s𝑠\scriptstyle swfragmentsww^{\prime}w𝑤ww𝑤ww𝑤wwfragmentsww^{\prime}wfragmentswfragmentsw^{\prime\prime}55\scriptscriptstyle 544\scriptscriptstyle 43fragments3\scriptscriptstyle 3^{*}33\scriptscriptstyle 322\scriptscriptstyle 21fragments1\scriptscriptstyle 1^{*}11\scriptscriptstyle 100\scriptscriptstyle 01¯¯1\scriptscriptstyle\overline{1}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}2¯¯2\scriptscriptstyle\overline{2}3¯¯3\scriptscriptstyle\overline{3}3¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 53¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 5
Figure 10. Coordinates for Moves 1 and 2, even chamber.

Even chambers: Assume first that w,wfragmentsw,ww,w^{\prime} and wfragmentswfragmentsw^{\prime\prime} belong to chamber IV. Because the hexagon diagonal endpoints are a pair of opposite vertices, there are no special edges. We will take t𝑡t to be such that wfragmentswfragmentsw^{\prime\prime} is outward and to the right from wfragmentsww^{\prime}, when viewed from the origin. (This is the situation, for example, when w,wfragmentsw,ww,w^{\prime} and wfragmentswfragmentsw^{\prime\prime} all lie in the strip 1<(α2,v)<0fragments1(α2,v)0-1<(\alpha_{2},v)<0, just below the upper boundary of chamber IV, as in Figure 10; note that although wfragmentswfragmentsw^{\prime\prime} is to the left of wfragmentsww^{\prime} in the picture, it is to the right when viewed from the origin.) Then the E, NW, and SW edges of wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}} and of wfragmentsHfragmentswfragments\mathcal{H}_{w^{\prime\prime}} are collinear; the NE, W, and SE edges of wfragmentsHfragmentswfragments\mathcal{H}_{w^{\prime\prime}} are one root string farther out than the corresponding edges of wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}}. We have w>wsfragmentswfragmentswfragmentssw^{\prime\prime}>w^{\prime\prime}s, and for y𝑦y a boundary point of wfragmentsHfragmentswfragments\mathcal{H}_{w^{\prime\prime}}, the six alcoves yufragmentsyuyu for uR(w)=s,tW(A2)fragmentsuR(wfragments)s,tW(A2)u\in R(w^{\prime\prime})=\langle\,s,t\,\rangle\cong W(A_{2}) are arranged in a small hexagon all sharing a common vertex, and lying inside wfragmentsHfragmentswfragments\mathcal{H}_{w^{\prime\prime}} (along its 0-, 1-, and 2-shells). By Proposition 2.1,

qyw=qyuwfor all such u.fragmentsq𝑦fragmentswfragmentsqfragmentsyufragmentswfragmentsfor all such u.q_{y}^{w^{\prime\prime}}=q_{yu}^{w^{\prime\prime}}\quad\text{for all such }u. (6.2)

Moreover, the union of these small hexagons equals the 0-, 1- and 2-shells of wfragmentsHfragmentswfragments\mathcal{H}_{w^{\prime\prime}}, and every such hexagon contains at least one alcove along the boundary of wfragmentsH𝑤\mathcal{H}_{w}. In other words, to verify the theorem for wfragmentswfragmentsw^{\prime\prime}, it suffices to verify it for x𝑥x on the 0-shell of wfragmentsH𝑤\mathcal{H}_{w}.

Repeating the analysis of the second paragraph of Move 1, we find that an Up alcove x𝑥x in wfragmentsH𝑤\mathcal{H}_{w} with coordinates (i0,i1,i2)fragments(i0,i1,i2)(i_{0},i_{1},i_{2}) acquires an additional Down alcove (in wfragmentsHfragmentswfragments\mathcal{H}_{w^{\prime\prime}} but not wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}}) at the end of the αjfragmentsα𝑗\alpha_{j} string through x𝑥x (j=fragmentsjj=0, 1, or 2) if and only if ijfragmentsi𝑗i_{j} is either odd and negative, or odd* and negative. Therefore the change in qxfragmentsq𝑥q_{x}^{\bullet} for Move 2 from wfragmentsww^{\prime} to wfragmentswfragmentsw^{\prime\prime} is

Δq2:=qxwqxw=j=02(δij,o<0+δij,<0)1,fragmentsΔq2assignq𝑥fragmentswfragmentsq𝑥fragmentswfragmentsj02(δfragmentsi𝑗,o0δfragmentsi𝑗,0)1,\Delta q_{2}:=q_{x}^{w^{\prime\prime}}-q_{x}^{w^{\prime}}=\sum_{j=0}^{2}(\delta_{i_{j},o<0}+\delta_{i_{j},*<0})-1, (6.3)

where the δ𝛿\delta functions have the obvious meanings.

Consider x𝑥x an Up alcove on the 0-shell of wfragmentsH𝑤\mathcal{H}_{w}. As observed in Move 1, the coordinates of x𝑥x are some permutation of (o,o,e)fragments(o,o,e)(o,o,e) and qxw=0fragmentsq𝑥fragmentsw0q_{x}^{w^{\prime}}=0 (since there are no special segments). In fact, one odd coordinate is positive and the other is negative, so Δq2=0fragmentsΔq20\Delta q_{2}=0 and thus qxw=0fragmentsq𝑥fragmentswfragments0q_{x}^{w^{\prime\prime}}=0. The reader can check that the same is true for the Down alcoves. By the remark in the previous paragraph, this completes the proof for Type 1 elements in even chambers.

Hα2,0fragmentsHfragmentsα2,0H_{\alpha_{2},0}Hα2,1fragmentsHfragmentsα2,1H_{\alpha_{2},1}00Hα1,0fragmentsHfragmentsα1,0H_{\alpha_{1},0}Hα1,1fragmentsHfragmentsα1,1H_{\alpha_{1},1}Hα~,0fragmentsHfragments~𝛼,0H_{\widetilde{\alpha},0}Hα~,1fragmentsHfragments~𝛼,1H_{\widetilde{\alpha},1}q𝑞qα1fragmentsα1\alpha_{1}α2fragmentsα2\alpha_{2}α~~𝛼\widetilde{\alpha}IIIIIIIVVVI012122012102012011b𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle bc𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle bq𝑞\scriptscriptstyle qa𝑎\scriptscriptstyle aa𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle aE𝐸\scriptstyle EEfragmentsE\scriptstyle E^{\prime}w𝑤we𝑒ew3fragmentsw3w_{3}w4fragmentsw4w_{4}w5fragmentsw5w_{5}w=w0fragmentsww0w=w_{0}w1fragmentsw1w_{1}w2fragmentsw2w_{2}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}w0=wfragmentsw0ww_{0}=ww1fragmentsw1w_{1}w5fragmentsw5w_{5}w4fragmentsw4w_{4}w3fragmentsw3w_{3}w2fragmentsw2w_{2}w𝑤wwfragmentsww^{\prime}s𝑠\scriptstyle sy𝑦yz=yfragmentszyz=y^{\prime}zfragmentszz^{\prime}w𝑤wwfragmentsww^{\prime}y=yfragmentsyyy=y^{\prime}z=zfragmentszzz=z^{\prime}s𝑠\scriptstyle swfragmentsww^{\prime}w𝑤ww𝑤ww𝑤wwfragmentsww^{\prime}wfragmentswfragmentsw^{\prime\prime}55\scriptscriptstyle 544\scriptscriptstyle 43fragments3\scriptscriptstyle 3^{*}33\scriptscriptstyle 322\scriptscriptstyle 21fragments1\scriptscriptstyle 1^{*}11\scriptscriptstyle 100\scriptscriptstyle 01¯¯1\scriptscriptstyle\overline{1}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}2¯¯2\scriptscriptstyle\overline{2}3¯¯3\scriptscriptstyle\overline{3}3¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 53¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 5w𝑤wwfragmentsww^{\prime}wfragmentswfragmentsw^{\prime\prime}77\scriptscriptstyle 766\scriptscriptstyle 65fragments5\scriptscriptstyle 5^{*}55\scriptscriptstyle 544\scriptscriptstyle 43fragments3\scriptscriptstyle 3^{*}33\scriptscriptstyle 322\scriptscriptstyle 21fragments1\scriptscriptstyle 1^{*}11\scriptscriptstyle 100\scriptscriptstyle 01¯¯1\scriptscriptstyle\overline{1}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}2¯¯2\scriptscriptstyle\overline{2}3¯¯3\scriptscriptstyle\overline{3}3¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 55¯¯5\scriptscriptstyle\overline{5}4¯¯4\scriptscriptstyle\overline{4}3¯fragments¯3\scriptscriptstyle\overline{3}^{*}3¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 5
Figure 11. Coordinates for Moves 1 and 2, odd chamber.

Odd chambers: Assume now that w,wfragmentsw,ww,w^{\prime} and wfragmentswfragmentsw^{\prime\prime} belong to chamber I. We will again take t𝑡t to be such that wfragmentswfragmentsw^{\prime\prime} is outward and to the right from wfragmentsww^{\prime}, when viewed from the origin. Then the NE, W, and SE edges of wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}} and of wfragmentsHfragmentswfragments\mathcal{H}_{w^{\prime\prime}} are collinear, while the E, NW, and SW edges of wfragmentsHfragmentswfragments\mathcal{H}_{w^{\prime\prime}} are one root string farther out than the corresponding edges of wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}}. As in the even chambers, qwfragmentsqfragmentswfragmentsq^{w^{\prime\prime}}_{\bullet} is constant on each small outer W(A2)fragmentsW(A2)W(A_{2}) hexagon comprising its 0-, 1-, and 2-shells, and each of these hexagons contains an alcove on the boundary of wfragmentsH𝑤\mathcal{H}_{w}. So it suffices to verify the theorem for x𝑥x on the 0-shell of wfragmentsH𝑤\mathcal{H}_{w}.

In the hexagon wfragmentsH𝑤\mathcal{H}_{w}, the diagonal from the S vertex intersects the NW edge at the alcove labeled 2, and the diagonal from the NW vertex intersects the SE edge at the alcove labeled 2¯¯2\overline{2}. We find that, for an Up alcove in wfragmentsH𝑤\mathcal{H}_{w} with coordinates (i0,i1,i2)fragments(i0,i1,i2)(i_{0},i_{1},i_{2}),

Δq2:=qxwqxw=δi0,o>0+δi0,>0+δi1,o>2¯+δi1,>0+δi2,o>0+δi2,>21.fragmentsΔq2assignq𝑥fragmentswfragmentsq𝑥fragmentswδfragmentsi0,o0δfragmentsi0,0δfragmentsi1,o¯2δfragmentsi1,0δfragmentsi2,o0δfragmentsi2,21.\Delta q_{2}:=q_{x}^{w^{\prime\prime}}-q_{x}^{w^{\prime}}=\delta_{i_{0},o>0}+\delta_{i_{0},*>0}+\delta_{i_{1},o>\overline{2}}+\delta_{i_{1},*>0}+\delta_{i_{2},o>0}+\delta_{i_{2},*>2}-1. (6.4)

Consider x𝑥x an Up alcove on the 0-shell of wfragmentsH𝑤\mathcal{H}_{w}. As observed in Move 1, the coordinates of x𝑥x are some permutation of (o,o,e)fragments(o,o,e)(o,o,e) and qxw=1fragmentsq𝑥fragmentsw1q_{x}^{w^{\prime}}=1 or 0 (depending on whether or not x𝑥x is in a special segment). In fact, one odd coordinate is positive and the other is negative, so (except when i1=1¯fragmentsi1¯1i_{1}=\overline{1}), Δq2=0fragmentsΔq20\Delta q_{2}=0 and qxw=qxwfragmentsq𝑥fragmentswfragmentsq𝑥fragmentswq_{x}^{w^{\prime\prime}}=q_{x}^{w^{\prime}}. The Up alcove x𝑥x where i1=1¯fragmentsi1¯1i_{1}=\overline{1}, with Δq2=1fragmentsΔq21\Delta q_{2}=1, lies on the SE edge of wfragmentsH𝑤\mathcal{H}_{w}, just outside the special segment for w𝑤w, whence qxw=qxw=0fragmentsq𝑥𝑤q𝑥fragmentsw0q_{x}^{w}=q_{x}^{w^{\prime}}=0 and qxw=1fragmentsq𝑥fragmentswfragments1q_{x}^{w^{\prime\prime}}=1. Since the α1fragmentsα1\alpha_{1} diagonal which determines the upper endpoint of the SE special segment moves up-and-right one string from wfragmentsww^{\prime} to wfragmentswfragmentsw^{\prime\prime}, the alcove x𝑥x lies in the small W(A2)fragmentsW(A2)W(A_{2}) hexagon determined by the new alcove y𝑦y at the upper right of the longer SE special segment for wfragmentswfragmentsw^{\prime\prime}, confirming that qyw=1fragmentsq𝑦fragmentswfragments1q_{y}^{w^{\prime\prime}}=1, as expected.

For Down alcoves, the analog of (6.4) is

Δq2:=qxwqxw=δi0,o>0+δi0,>0+δi1,>2¯+δi1,o>0+δi2,>0+δi2,o>21.fragmentsΔq2assignq𝑥fragmentswfragmentsq𝑥fragmentswδfragmentsi0,o0δfragmentsi0,0δfragmentsi1,¯2δfragmentsi1,o0δfragmentsi2,0δfragmentsi2,o21.\Delta q_{2}:=q_{x}^{w^{\prime\prime}}-q_{x}^{w^{\prime}}=\delta_{i_{0},o>0}+\delta_{i_{0},*>0}+\delta_{i_{1},*>\overline{2}}+\delta_{i_{1},o>0}+\delta_{i_{2},*>0}+\delta_{i_{2},o>2}-1. (6.5)

We again leave it to the reader to check that this implies the formulas in the theorem statement for Down alcoves on the 0-shell of wfragmentsH𝑤\mathcal{H}_{w}, as required. In summary, for every x𝑥x on the 0-, 1-, or 2-shell of wfragmentsHfragmentswfragments\mathcal{H}_{w^{\prime\prime}}, the value qxwfragmentsq𝑥fragmentswfragmentsq_{x}^{w^{\prime\prime}} is as claimed. ∎

Remark 6.2.

One can use the same reflection Move 1 and Move 2 formulas to prove inductively that qwx>0fragmentsq𝑤𝑥0q^{w}_{x}>0 for all x𝑥x on and inside the 3-shell of wfragmentsH𝑤\mathcal{H}_{w} whenever w𝑤w is not spiral. This immediately implies that the Lookup Conjecture is (trivially) true for non-spiral elements in A~2fragments~𝐴2\widetilde{A}_{2}. In fact, this was our original approach, until we noticed that the Translation Move could be used to give more detailed information on the precise values of q𝑞q.

7. Base cases

In this section we analyze the base cases for w𝑤w. By Remark 5.3, if XwfragmentsX𝑤X_{w} is a non-spiral rationally smooth Schubert variety, then w𝑤w is necessarily a base case, so as a consequence of our analysis, we obtain a description of the rationally Schubert varieties in type A~2fragments~𝐴2\widetilde{A}_{2} (Corollary 7.1).

There are four types of base cases for w𝑤w in a chamber 𝒞𝒞\mathcal{C}: either 𝒞𝒞\mathcal{C} is even or odd; the alcove wAfragmentswAwA_{\circ} lies in the root strip adjacent to a fundamental root strip bounding 𝒞𝒞\mathcal{C}; and wAfragmentswAwA_{\circ} shares either an edge or a vertex with a spiral (fundamental root strip) alcove. Recall also: either there are two simple reflections s𝑠s such that ws<wfragmentswswws<w, in which case w𝑤w is of Type 1, or there is one simple reflection s𝑠s such that ws<wfragmentswswws<w, in which case w𝑤w is of Type 2.

Case 1: 𝒞𝒞\mathcal{C} is even, and the alcove for w𝑤w shares an edge with a fundamental strip. In this case, w𝑤w is a non-spiral element of the form zsfragmentszszs, where z𝑧z is an even-length spiral element, s𝑠s is a simple reflection, and (w)=(z)+1fragments(w)(z)1\ell(w)=\ell(z)+1. Such an element is necessarily Type 1. Following Billey and Crites [BiCr:12, Section 2.5], we call such an element w𝑤w twisted spiral; note that by definition, a twisted spiral element has odd length. We claim that qxw=0fragmentsq𝑥𝑤0q_{x}^{w}=0 for all xwfragmentsxwx\leq w. In fact, this follows from the work of Billey and Crites: they proved that the Schubert varieties corresponding to twisted spiral elements are rationally smooth at every point (see [BiCr:12, Theorem 1]), so the Carrell-Peterson criterion implies the claim. We will give a different proof using the methods of this paper.

The proof is by induction on (w)fragments(w)\ell(w) using translation Moves 1 and 2, as in Theorem 6.1. The smallest value of (w)fragments(w)\ell(w) which can occur is (w)=3fragments(w)3\ell(w)=3, and one can check directly that the claim holds in this case. Now assume, as in the proof of Theorem 6.1, that w𝑤w is in chamber IV, with w<ws=:w<wt=:wfragmentswws:wwt:wfragmentsw<ws=:w^{\prime}<w^{\prime}t=:w^{\prime\prime} as before. Then w𝑤w and wfragmentswfragmentsw^{\prime\prime} are both twisted spiral. We are assuming the result for w𝑤w, and wish to prove it for wfragmentswfragmentsw^{\prime\prime}. We already know, by Theorem 6.1, that qxw=0fragmentsq𝑥fragmentswfragments0q_{x}^{w^{\prime\prime}}=0 for x𝑥x on the 0-, 1-, or 2-shell of wfragmentsHfragmentswfragments\mathcal{H}_{w^{\prime\prime}}. For x𝑥x belonging to an Up alcove in the interior of wfragmentsH𝑤\mathcal{H}_{w}, the coordinates of x𝑥x are some permutation of even >0fragments0>0, odd >0fragments0>0, and odd* >0fragments0>0. Thus by (6.1) and (6.3), Δq1=1fragmentsΔq11\Delta q_{1}=1 and Δq2=1fragmentsΔq21\Delta q_{2}=-1. Since by induction qxw=0fragmentsq𝑥𝑤0q_{x}^{w}=0, we have qxw=0fragmentsq𝑥fragmentswfragments0q_{x}^{w^{\prime\prime}}=0. As usual, we leave it to the reader to check the result for Down alcoves.

Case 2: 𝒞𝒞\mathcal{C} is even, and the alcove for w𝑤w shares a vertex with a fundamental strip. See Figure LABEL:fig:fish. In this case, w𝑤w is of Type 2, (w)fragments(w)\ell(w) is even, and (w)4fragments(w)4\ell(w)\geq 4. We know by Theorem 6.1 that qwx=0fragmentsq𝑤𝑥0q^{w}_{x}=0 for x𝑥x on the 0- and 1-shells. We claim that qwx=1fragmentsq𝑤𝑥1q^{w}_{x}=1 for all x𝑥x on or inside the 2-shell.

We prove the claim as follows. The k𝑘k-shells for k2fragmentsk2k\geq 2 coincide with the hexagon zfragmentsH𝑧\mathcal{H}_{z} where z:=z1fragmentszassignz1z:=z_{1} shown in Figure LABEL:fig:fish. Then z𝑧z is twisted spiral, so for all xzfragmentsxzx\leq z, qzx=0fragmentsq𝑧𝑥0q^{z}_{x}=0. We will compute Δq:=qwxqzxfragmentsΔqassignq𝑤𝑥q𝑧𝑥\Delta q:=q^{w}_{x}-q^{z}_{x}. Notice that l(w)=l(z)+3fragmentsl(w)l(z)3l(w)=l(z)+3.

Label the alcoves x𝑥x in zfragmentsH𝑧\mathcal{H}_{z} by coordinates (i0,i1,i2)fragments(i0,i1,i2)(i_{0},i_{1},i_{2}) as described after the statement of Theorem 6.1 (with z𝑧z in place of x𝑥x). We need only count how many additional alcoves there are in wzfragmentsH𝑤H𝑧\mathcal{H}_{w}\setminus\mathcal{H}_{z} on the root strings through x𝑥x in each direction α0,α1,α2fragmentsα0,α1,α2\alpha_{0},\alpha_{1},\alpha_{2}. Fix j, 0j2fragmentsj, 0j2j,\ 0\leq j\leq 2. First, notice that if the coordinate ij=1¯fragmentsi𝑗¯1i_{j}=\overline{1}, meaning x𝑥x lies along one of the edges of zfragmentsH𝑧\mathcal{H}_{z}, then there are two additional alcoves, one of each orientation, at each end of the αjfragmentsα𝑗\alpha_{j} root string through x𝑥x. So this root string contributes +2fragments2+2 to ΔqfragmentsΔq\Delta q. The same statements are true if ij=ofragmentsi𝑗oi_{j}=o^{*}. But if ij=ofragmentsi𝑗oi_{j}=o or e𝑒e, then there is only one additional alcove at each end of the αjfragmentsα𝑗\alpha_{j} root string through x𝑥x, one Up and one Down. So these strings contribute +1fragments1+1 to ΔqfragmentsΔq\Delta q.

One checks immediately that the coordinates of the alcoves along the edges of zfragmentsH𝑧\mathcal{H}_{z} are some permutation of (1¯,o,e)fragments(¯1,o,e)(\overline{1},o,e), whereas the interior alcove coordinates are some permutation of (o,o,e)fragments(o,o,e)(o^{*},o,e). Therefore in any case,

Δq=2+1+13=1,fragmentsΔq21131,\Delta q=2+1+1-3=1,

which, together with the fact that qzx=0fragmentsq𝑧𝑥0q^{z}_{x}=0, proves the claim.

We remark that in the setting of Case 2, the 222-shell is empty if and only if (w)=4fragments(w)4\ell(w)=4, and then qwx=0fragmentsq𝑤𝑥0q^{w}_{x}=0 for all xwfragmentsxwx\leq w.

Hα2,0fragmentsHfragmentsα2,0H_{\alpha_{2},0}Hα2,1fragmentsHfragmentsα2,1H_{\alpha_{2},1}00Hα1,0fragmentsHfragmentsα1,0H_{\alpha_{1},0}Hα1,1fragmentsHfragmentsα1,1H_{\alpha_{1},1}Hα~,0fragmentsHfragments~𝛼,0H_{\widetilde{\alpha},0}Hα~,1fragmentsHfragments~𝛼,1H_{\widetilde{\alpha},1}q𝑞qα1fragmentsα1\alpha_{1}α2fragmentsα2\alpha_{2}α~~𝛼\widetilde{\alpha}IIIIIIIVVVI012122012102012011b𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle bc𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle bq𝑞\scriptscriptstyle qa𝑎\scriptscriptstyle aa𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle aE𝐸\scriptstyle EEfragmentsE\scriptstyle E^{\prime}w𝑤we𝑒ew3fragmentsw3w_{3}w4fragmentsw4w_{4}w5fragmentsw5w_{5}w=w0fragmentsww0w=w_{0}w1fragmentsw1w_{1}w2fragmentsw2w_{2}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}w0=wfragmentsw0ww_{0}=ww1fragmentsw1w_{1}w5fragmentsw5w_{5}w4fragmentsw4w_{4}w3fragmentsw3w_{3}w2fragmentsw2w_{2}w𝑤wwfragmentsww^{\prime}s𝑠\scriptstyle sy𝑦yz=yfragmentszyz=y^{\prime}zfragmentszz^{\prime}w𝑤wwfragmentsww^{\prime}y=yfragmentsyyy=y^{\prime}z=zfragmentszzz=z^{\prime}s𝑠\scriptstyle swfragmentsww^{\prime}w𝑤ww𝑤ww𝑤wwfragmentsww^{\prime}wfragmentswfragmentsw^{\prime\prime}55\scriptscriptstyle 544\scriptscriptstyle 43fragments3\scriptscriptstyle 3^{*}33\scriptscriptstyle 322\scriptscriptstyle 21fragments1\scriptscriptstyle 1^{*}11\scriptscriptstyle 100\scriptscriptstyle 01¯¯1\scriptscriptstyle\overline{1}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}2¯¯2\scriptscriptstyle\overline{2}3¯¯3\scriptscriptstyle\overline{3}3¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 53¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 5w𝑤wwfragmentsww^{\prime}wfragmentswfragmentsw^{\prime\prime}77\scriptscriptstyle 766\scriptscriptstyle 65fragments5\scriptscriptstyle 5^{*}55\scriptscriptstyle 544\scriptscriptstyle 43fragments3\scriptscriptstyle 3^{*}33\scriptscriptstyle 322\scriptscriptstyle 21fragments1\scriptscriptstyle 1^{*}11\scriptscriptstyle 100\scriptscriptstyle 01¯¯1\scriptscriptstyle\overline{1}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}2¯¯2\scriptscriptstyle\overline{2}3¯¯3\scriptscriptstyle\overline{3}3¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 55¯¯5\scriptscriptstyle\overline{5}4¯¯4\scriptscriptstyle\overline{4}3¯fragments¯3\scriptscriptstyle\overline{3}^{*}3¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 51p𝑝p1p~~𝑝\widetilde{p}00000000110w𝑤w0000000wfragmentsww^{\prime}0000000000111111111111111111111111111000000100001001000010100000zfragmentszz^{\prime}
Figure 12. Base Case 3

Case 3: 𝒞𝒞\mathcal{C} is odd, and the alcove for w𝑤w shares an edge with a fundamental strip. In this case, w𝑤w is a non-spiral element of the form zsfragmentszszs, where z𝑧z is an odd-length spiral element, s𝑠s is a simple reflection, and (w)=(z)+1fragments(w)(z)1\ell(w)=\ell(z)+1. See Figure 12. In this case, w𝑤w is of Type 1, (w)fragments(w)\ell(w) is even, and (w)4fragments(w)4\ell(w)\geq 4. If (w)=4fragments(w)4\ell(w)=4, there are no special segments, the 00-, 111-, and 222-shells exhaust wfragmentsH𝑤\mathcal{H}_{w}, and one can check that qwx=0fragmentsq𝑤𝑥0q^{w}_{x}=0 for all xwfragmentsxwx\leq w.

Assume now that (w)6fragments(w)6\ell(w)\geq 6. In this case, there is exactly one special segment along an outer edge of wfragmentsH𝑤\mathcal{H}_{w}. The right R(w)fragmentsR(w)R(w)-orbits are little A2fragmentsA2A_{2} hexagons, and qwxfragmentsq𝑤𝑥q^{w}_{x} is the same for all x𝑥x in a given R(w)fragmentsR(w)R(w)-orbit. Suppose xwfragmentsxwx\leq w. We claim that qxw=1fragmentsq𝑥𝑤1q_{x}^{w}=1, except that qxw=0fragmentsq𝑥𝑤0q_{x}^{w}=0 if x𝑥x is on the 0-, 1-, or 2-shell of wfragmentsH𝑤\mathcal{H}_{w} and xR(w)fragmentsxR(w)xR(w) does not intersect the special segment of wfragmentsH𝑤\mathcal{H}_{w}. Observe that if x𝑥x is on the 0-, 1-, or 2-shell of wfragmentsH𝑤\mathcal{H}_{w}, then the claim follows directly from Theorem 6.1. Therefore assume x𝑥x is on a k𝑘k-shell for k3fragmentsk3k\geq 3. We will show (see Theorem 8.1 case I.1.(ii)) that the k𝑘k-shells for k3fragmentsk3k\geq 3 coincide with zfragmentsHfragmentsz\mathcal{H}_{z^{\prime}} where zfragmentszz^{\prime} is the element shown in Figures 12 and 15. Since x𝑥x is in zfragmentsHfragmentsz\mathcal{H}_{z^{\prime}} and zfragmentszz^{\prime} is twisted spiral, we have qzx=0fragmentsqfragmentsz𝑥0q^{z^{\prime}}_{x}=0. Translation into the chamber takes zfragmentszz^{\prime} to wfragmentsww^{\prime}. By Theorem 5.1, qwx=qzx+2=0+2=2fragmentsqfragmentsw𝑥qfragmentsz𝑥2022q^{w^{\prime}}_{x}=q^{z^{\prime}}_{x}+2=0+2=2.

To compute qwxfragmentsq𝑤𝑥q^{w}_{x}, note that the hexagon wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}} is wfragmentsH𝑤\mathcal{H}_{w} with the two short corners truncated: cut off the small grey hexagons in the NE and W corners (when w𝑤w is as drawn in Figure 15) to obtain a semiregular hexagon wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}} all of whose short edges have length 4. The fact that x𝑥x is inside the little hexagon zfragmentsHfragmentsz\mathcal{H}_{z^{\prime}} implies that none of the root strings through x𝑥x contain any grey alcoves in the portion of wfragmentsH𝑤\mathcal{H}_{w} that was cut off to form wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}}. By Lemma 3.2, (w)=(w)1fragments(w)(w)1\ell(w^{\prime})=\ell(w)-1. Thus, qwx=qwx1=21=1fragmentsq𝑤𝑥qfragmentsw𝑥1211q^{w}_{x}=q^{w^{\prime}}_{x}-1=2-1=1.

Hα2,0fragmentsHfragmentsα2,0H_{\alpha_{2},0}Hα2,1fragmentsHfragmentsα2,1H_{\alpha_{2},1}00Hα1,0fragmentsHfragmentsα1,0H_{\alpha_{1},0}Hα1,1fragmentsHfragmentsα1,1H_{\alpha_{1},1}Hα~,0fragmentsHfragments~𝛼,0H_{\widetilde{\alpha},0}Hα~,1fragmentsHfragments~𝛼,1H_{\widetilde{\alpha},1}q𝑞qα1fragmentsα1\alpha_{1}α2fragmentsα2\alpha_{2}α~~𝛼\widetilde{\alpha}IIIIIIIVVVI012122012102012011b𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle bc𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle bq𝑞\scriptscriptstyle qa𝑎\scriptscriptstyle aa𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle aE𝐸\scriptstyle EEfragmentsE\scriptstyle E^{\prime}w𝑤we𝑒ew3fragmentsw3w_{3}w4fragmentsw4w_{4}w5fragmentsw5w_{5}w=w0fragmentsww0w=w_{0}w1fragmentsw1w_{1}w2fragmentsw2w_{2}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}w0=wfragmentsw0ww_{0}=ww1fragmentsw1w_{1}w5fragmentsw5w_{5}w4fragmentsw4w_{4}w3fragmentsw3w_{3}w2fragmentsw2w_{2}w𝑤wwfragmentsww^{\prime}s𝑠\scriptstyle sy𝑦yz=yfragmentszyz=y^{\prime}zfragmentszz^{\prime}w𝑤wwfragmentsww^{\prime}y=yfragmentsyyy=y^{\prime}z=zfragmentszzz=z^{\prime}s𝑠\scriptstyle swfragmentsww^{\prime}w𝑤ww𝑤ww𝑤wwfragmentsww^{\prime}wfragmentswfragmentsw^{\prime\prime}55\scriptscriptstyle 544\scriptscriptstyle 43fragments3\scriptscriptstyle 3^{*}33\scriptscriptstyle 322\scriptscriptstyle 21fragments1\scriptscriptstyle 1^{*}11\scriptscriptstyle 100\scriptscriptstyle 01¯¯1\scriptscriptstyle\overline{1}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}2¯¯2\scriptscriptstyle\overline{2}3¯¯3\scriptscriptstyle\overline{3}3¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 53¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 5w𝑤wwfragmentsww^{\prime}wfragmentswfragmentsw^{\prime\prime}77\scriptscriptstyle 766\scriptscriptstyle 65fragments5\scriptscriptstyle 5^{*}55\scriptscriptstyle 544\scriptscriptstyle 43fragments3\scriptscriptstyle 3^{*}33\scriptscriptstyle 322\scriptscriptstyle 21fragments1\scriptscriptstyle 1^{*}11\scriptscriptstyle 100\scriptscriptstyle 01¯¯1\scriptscriptstyle\overline{1}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}2¯¯2\scriptscriptstyle\overline{2}3¯¯3\scriptscriptstyle\overline{3}3¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 55¯¯5\scriptscriptstyle\overline{5}4¯¯4\scriptscriptstyle\overline{4}3¯fragments¯3\scriptscriptstyle\overline{3}^{*}3¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 51p𝑝p1p~~𝑝\widetilde{p}00000000110w𝑤w0000000wfragmentsww^{\prime}0000000000111111111111111111111111111000000100001001000010100000zfragmentszz^{\prime}w=u0fragmentswu0w=u_{0}u1fragmentsu1u_{1}u2fragmentsu2u_{2}u3fragmentsu3u_{3}u4fragmentsu4u_{4}u5fragmentsu5u_{5}AfragmentsA\scriptstyle A^{\prime}AfragmentsAfragments\scriptstyle A^{\prime\prime}wfragmentsw\scriptstyle w^{\prime}0000001p𝑝p1p~~𝑝\widetilde{p}11111122222200000000000000111112121001212122222222112222112212212211000000100110021021011002102011000000
Figure 13. Base Case 4

Case 4: 𝒞𝒞\mathcal{C} is odd, and the alcove for w𝑤w shares a vertex with a fundamental strip. In this case, w𝑤w is of Type 2, so the right R(w)fragmentsR(w)R(w)-orbits are little diamonds. In this case, (w)fragments(w)\ell(w) is odd, and (w)5fragments(w)5\ell(w)\geq 5. If (w)=5fragments(w)5\ell(w)=5, then there are no special segments, and one can check that if x𝑥x is on the 00-shell or the 111-shell, qwx=0fragmentsq𝑤𝑥0q^{w}_{x}=0; if x𝑥x is one of the two elements on the 222-shell, then qwx=2fragmentsq𝑤𝑥2q^{w}_{x}=2.

Assume now that (w)7fragments(w)7\ell(w)\geq 7. There is one special segment on the 0-shell. Suppose xwfragmentsxwx\leq w. By Theorem 6.1, if x𝑥x is on the 0-shell or 1-shell of wfragmentsH𝑤\mathcal{H}_{w}, then qwx=0fragmentsq𝑤𝑥0q^{w}_{x}=0 if and only if R(w)fragmentsR(w)R(w)-orbit of x𝑥x does not intersect the special segment. If x𝑥x is on the 0- or 1- shell and xR(w)fragmentsxR(w)xR(w) intersects the special segment (shown in purple in Figure 13), then qwx=1fragmentsq𝑤𝑥1q^{w}_{x}=1.

If x𝑥x is not in the 0-shell or 1-shell of wfragmentsH𝑤\mathcal{H}_{w}, then qwxfragmentsq𝑤𝑥q^{w}_{x} is either 111 or 222. For such x𝑥x, there is an (unfortunately somewhat complicated) explicit description of the values of qwxfragmentsq𝑤𝑥q^{w}_{x}. We begin with some geometry. Label the vertices of wfragmentsH𝑤\mathcal{H}_{w} as follows. Set u0=wfragmentsu0wu_{0}=w, and let u1fragmentsu1u_{1} denote the vertex of the special edge for which u0u1fragmentsu0u1u_{0}u_{1} is an edge. Moving from u0fragmentsu0u_{0} to u1fragmentsu1u_{1} determines a direction—either clockwise or counterclockwise—and continuing in that direction, label the remaining vertices u2,u3,u4fragmentsu2,u3,u4u_{2},u_{3},u_{4} and u5fragmentsu5u_{5}, in order. If the direction is counterclockwise, then for i1fragmentsi1i\geq 1, ui=wifragmentsu𝑖w𝑖u_{i}=w_{i}; otherwise, ui=w6ifragmentsu𝑖wfragments6iu_{i}=w_{6-i}. See Figure 13, in which ui=wifragmentsu𝑖w𝑖u_{i}=w_{i} for all i𝑖i.

Let DifragmentsD𝑖D_{i} be the part of the diagonal through uifragmentsu𝑖u_{i} which is not on the 0- or 1-shells. Note that D0=D3fragmentsD0D3D_{0}=D_{3}. Among the set of alcove centers xqfragmentsxqxq in wfragmentsH𝑤\mathcal{H}_{w}, the complement of the set of xqfragmentsxqxq on the 0- and 1-shells is the disjoint union of the xqfragmentsxqxq in the triangular region with vertices D0D4fragmentsD0D4D_{0}\cap D_{4}, D0D5fragmentsD0D5D_{0}\cap D_{5}, and D4D5fragmentsD4D5D_{4}\cap D_{5} (shown in red in Figure 13); the segments D1fragmentsD1D_{1} and D2fragmentsD2D_{2} (colored green); and the xqfragmentsxqxq on four additional segments: two parallel segments between D1fragmentsD1D_{1} and D4fragmentsD4D_{4}, and two between D2fragmentsD2D_{2} and D5fragmentsD5D_{5} (all four colored blue). Two alcoves AfragmentsAA^{\prime} and AfragmentsAfragmentsA^{\prime\prime} near the u4u5fragmentsu4u5u_{4}u_{5} edge each lie on two of these blue segments, and each blue segment has either AfragmentsAA^{\prime} or AfragmentsAfragmentsA^{\prime\prime} at one end.

Now we can explicitly describe qwxfragmentsq𝑤𝑥q^{w}_{x}. If x𝑥x is in the red triangular region, then qwx=2fragmentsq𝑤𝑥2q^{w}_{x}=2. If x𝑥x is on a green segment D1fragmentsD1D_{1} or D2fragmentsD2D_{2}, then qwx=1fragmentsq𝑤𝑥1q^{w}_{x}=1. On each of the remaining four blue segments, qwxfragmentsq𝑤𝑥q^{w}_{x} is as follows. If x𝑥x is on either end of the segment, then qwx=2fragmentsq𝑤𝑥2q^{w}_{x}=2, and moving from one end of the segment to the other, qwxfragmentsq𝑤𝑥q^{w}_{x} alternates in the pattern 2,1,2,,1,2fragments2,1,2,,1,22,1,2,\dots,1,2.

To prove these assertions, recall that w𝑤w is of Type 2, so there is a unique simple reflection s𝑠s such that w>ws=:wfragmentswws:ww>ws=:w^{\prime}. Then wfragmentsww^{\prime} is of Type 1 and shares an edge with the same fundamental root strip with which w𝑤w shares a vertex; see Figure 13 (where wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}} is indicated by the dashed line). In particular, wfragmentsww^{\prime} is in Base Case 3, and wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}} is the 1-shell of wfragmentsH𝑤\mathcal{H}_{w}. For each xwfragmentsxwx\leq w^{\prime} we can determine qwxfragmentsq𝑤𝑥q^{w}_{x} via Move 1 and the known values of qwxfragmentsqfragmentsw𝑥q^{w^{\prime}}_{x} from Case 3, above. We use the earlier Move 1 formulas for Δq1fragmentsΔq1\Delta q_{1} in terms of coordinates (i0,i1,i2)fragments(i0,i1,i2)(i_{0},i_{1},i_{2}) as in Figures 10 and 11, from (6.1) and the subsequent text (with the roles of w𝑤w and wfragmentsww^{\prime} reversed—in particular, the coordinates are based on the alcoves around the wfragmentsHfragmentsw\mathcal{H}_{w^{\prime}} hexagon edges).

By the discussion in the second paragraph of Case 4, we may assume that x𝑥x is on or inside the 2-shell of w𝑤w; i.e., the 1-shell of wfragmentsww^{\prime}. Thus, x𝑥x is either on a green or blue root string, or in the red triangle. We treat each of these cases in turn. By symmetry, it suffices to analyze the NW-to-SE green and blue root strings where i1fragmentsi1i_{1} is constant, plus the red triangle.

On the green string where i1=2¯fragmentsi1¯2i_{1}=\overline{2}, the alcove coordinates are either (o,2¯,o)fragments(o,¯2,o)(o,\overline{2},o^{*}) or (o,2¯,o)fragments(o,¯2,o)(o^{*},\overline{2},o), according to whether the alcove is Down or Up. This string does not contain any alcoves between two parallel diagonals, so the formula for ΔqfragmentsΔq\Delta q is the same for Up and Down alcoves: Δq=1+11=1fragmentsΔq1111\Delta q=1+1-1=1. Hence qwx=qwx+Δq=0+1=1fragmentsq𝑤𝑥qfragmentsw𝑥Δq011q^{w}_{x}=q^{w^{\prime}}_{x}+\Delta q=0+1=1.

On the lower blue string, i1=1¯fragmentsi1¯1i_{1}=\overline{1}^{*}. The Up alcove coordinates are (e,1¯,o)fragments(e,¯1,o)(e,\overline{1}^{*},o^{*}) so Δq=1+1+11=2fragmentsΔq11112\Delta q=1+1+1-1=2 and qwx=0+2=2fragmentsq𝑤𝑥022q^{w}_{x}=0+2=2. (This includes the bottom right alcove on the string, AfragmentsAA^{\prime}.) The Down alcove coordinates are (o,1¯,e)fragments(o,¯1,e)(o^{*},\overline{1}^{*},e). This is a string between two parallel diagonals, so the middle coordinate 1¯fragments¯1\overline{1}^{*} does not contribute to an increase in q𝑞q. In fact, Δq=1+11=1fragmentsΔq1111\Delta q=1+1-1=1 and qwx=0+1=1fragmentsq𝑤𝑥011q^{w}_{x}=0+1=1.

On the upper blue string, i1=1¯fragmentsi1¯1i_{1}=\overline{1}. The Up alcove coordinates are (o,1¯,e)fragments(o,¯1,e)(o,\overline{1},e), Δq=11=0fragmentsΔq110\Delta q=1-1=0, and qwx=1+0=1fragmentsq𝑤𝑥101q^{w}_{x}=1+0=1. The Down alcoves other than the bottom right one have coordinates (e,1¯,o)fragments(e,¯1,o)(e,\overline{1},o). This again is a string between two parallel diagonals, so Δq=1+11=1fragmentsΔq1111\Delta q=1+1-1=1, and qwx=1+1=2fragmentsq𝑤𝑥112q^{w}_{x}=1+1=2. The bottom right alcove, AfragmentsAfragmentsA^{\prime\prime}, has coordinates (e,1¯,1)fragments(e,¯1,1)(e,\overline{1},1). This alcove lies between both pairs of parallel diagonals, so Δq=1+1+11=2fragmentsΔq11112\Delta q=1+1+1-1=2, whence qwx=0+2=2fragmentsq𝑤𝑥022q^{w}_{x}=0+2=2.

Finally, assume x𝑥x lies on or inside the red triangle. One checks that the coordinates of x𝑥x are some permutation of (o,o,e)fragments(o,o,e)(o,o^{*},e). Since this region avoids the strings between parallel diagonals, the formulas for Up and Down alcoves are the same: Δq=1+11=1fragmentsΔq1111\Delta q=1+1-1=1 and qwx=1+1=2fragmentsq𝑤𝑥112q^{w}_{x}=1+1=2.

Corollary 7.1.

The Schubert variety XwfragmentsX𝑤X_{w} is rationally smooth if and only if one of the following holds:

(a) (w)3fragments(w)3\ell(w)\leq 3.

(b) w𝑤w is in an even chamber, the alcove for w𝑤w shares a vertex with a fundamental strip, and (w)=4fragments(w)4\ell(w)=4. Equivalently, w=sisjsiskfragmentsws𝑖s𝑗s𝑖s𝑘w=s_{i}s_{j}s_{i}s_{k} for {i,j,k}={0,1,2}fragments{i,j,k}{0,1,2}\{i,j,k\}=\{0,1,2\}.

(c) w𝑤w is in an odd chamber, the alcove for w𝑤w shares an edge with a fundamental strip, and (w)=4fragments(w)4\ell(w)=4. Equivalently, w=sksisjsifragmentsws𝑘s𝑖s𝑗s𝑖w=s_{k}s_{i}s_{j}s_{i} for {i,j,k}={0,1,2}fragments{i,j,k}{0,1,2}\{i,j,k\}=\{0,1,2\}.

(d) w𝑤w is twisted spiral.

Proof.

If w𝑤w is spiral, then XwfragmentsX𝑤X_{w} is rationally smooth if and only if (w)3fragments(w)3\ell(w)\leq 3 by [GrLi:15]. Therefore, we may assume w𝑤w is non-spiral. By Remark 5.3, if XwfragmentsX𝑤X_{w} is rationally smooth, then XwfragmentsX𝑤X_{w} is a base case. Our analysis of the base cases shows that qwx=0fragmentsq𝑤𝑥0q^{w}_{x}=0 for all xwfragmentsxwx\leq w (which is equivalent to rational smoothness of XwfragmentsX𝑤X_{w}) in exactly the following cases: Base Case 1; Base Case 2 with (w)=4fragments(w)4\ell(w)=4; Base Case 3 with (w)=4fragments(w)4\ell(w)=4. These are exactly parts (d), (b), and (c) of the Corollary; part (a) of the corollary (for non-spiral w𝑤w) corresponds to Base Case 1 with (w)=3fragments(w)3\ell(w)=3. The reduced expressions in (b) and (c) can be obtained by inspection. ∎

Note that conditions of the corollary are mutually exclusive, except that the twisted spiral element w=sisjsifragmentsws𝑖s𝑗s𝑖w=s_{i}s_{j}s_{i} satisfies both (a) and (d) of the corollary. We will see below that the Schubert varieties in cases (a)-(c) of the corollary are smooth (see Corollary 7.1), so XwfragmentsX𝑤X_{w} is rationally smooth if and only if XwfragmentsX𝑤X_{w} is smooth or w𝑤w is twisted spiral. This result was first proved by Billey and Crites [BiCr:12]; see Remark LABEL:r:BilleyCrites for further discussion.

8. The nrs locus for affine A2fragmentsA2A_{2}

In this section we show that for a non-spiral Schubert variety XwfragmentsX𝑤X_{w} of type A~2fragments~𝐴2\widetilde{A}_{2}, the point xfragmentsxBx\mathcal{B} is nrs in XwfragmentsX𝑤X_{w} if and only if qwx>0fragmentsq𝑤𝑥0q^{w}_{x}>0 (Corollary LABEL:c:trivial-rs). This result has a number of consequences. As noted in the introduction, combined with the work in [GrLi:15] for spiral Schubert varieties, it implies the Lookup Conjecture for type A~2fragments~𝐴2\widetilde{A}_{2}. Moreover, combined with our analysis of qwxfragmentsq𝑤𝑥q^{w}_{x} in previous sections, Corollary LABEL:c:trivial-rs yields a description of the nrs locus of a non-spiral Schubert variety in terms of the geometry of the Bruhat hexagon wfragmentsH𝑤\mathcal{H}_{w} (see Remark LABEL:r:shell-rs) as well as a description of the maximal nrs z<wfragmentszwz<w (see Corollary LABEL:c:Maxnrs).

The results of this section rely on the following key theorem.

Theorem 8.1.

Let wWfragmentswWw\in W be non-spiral, and yxwfragmentsyxwy\leq x\leq w. If qxw>0fragmentsq𝑥𝑤0q_{x}^{w}>0 then qyw>0fragmentsq𝑦𝑤0q_{y}^{w}>0.

Proof.

The proof relies heavily on the characterization of the locus where qw>0fragmentsq𝑤0q^{w}_{\bullet}>0 in Corollary 5.2, and amounts to showing that this region contains the Bruhat hexagons of all its elements.

First, if w𝑤w is a twisted spiral element, as in Case 1 in Section 7, then qxw=0fragmentsq𝑥𝑤0q_{x}^{w}=0 for all xwfragmentsxwx\leq w and there is nothing to prove. So assume henceforth that w𝑤w is not twisted spiral.

Assume the hypothesis of the theorem. Our strategy is to identify a small number (at most four) of elements z𝑧z such that xzwfragmentsxzwx\leq z\leq w, qzw>0fragmentsq𝑧𝑤0q_{z}^{w}>0, and the entire hexagon zfragmentsH𝑧\mathcal{H}_{z} is contained in the region where qw>0fragmentsq𝑤0q^{w}_{\bullet}>0. In particular, since yzfragmentsyzy\leq z, we deduce that qyw>0fragmentsq𝑦𝑤0q_{y}^{w}>0, as required. As a corollary, we will have identifed the maximal elements z<wfragmentszwz<w having qzw>0fragmentsq𝑧𝑤0q_{z}^{w}>0.

Let t(α)fragmentst(α)t(\alpha) be the translation into the chamber of w𝑤w.

I. We will treat first the cases where qxw>0fragmentsq𝑥𝑤0q_{x}^{w}>0 by virtue of part (a) or (b) of Corollary 5.2.

Hα2,0fragmentsHfragmentsα2,0H_{\alpha_{2},0}Hα2,1fragmentsHfragmentsα2,1H_{\alpha_{2},1}00Hα1,0fragmentsHfragmentsα1,0H_{\alpha_{1},0}Hα1,1fragmentsHfragmentsα1,1H_{\alpha_{1},1}Hα~,0fragmentsHfragments~𝛼,0H_{\widetilde{\alpha},0}Hα~,1fragmentsHfragments~𝛼,1H_{\widetilde{\alpha},1}q𝑞qα1fragmentsα1\alpha_{1}α2fragmentsα2\alpha_{2}α~~𝛼\widetilde{\alpha}IIIIIIIVVVI012122012102012011b𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle bc𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle bq𝑞\scriptscriptstyle qa𝑎\scriptscriptstyle aa𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle aE𝐸\scriptstyle EEfragmentsE\scriptstyle E^{\prime}w𝑤we𝑒ew3fragmentsw3w_{3}w4fragmentsw4w_{4}w5fragmentsw5w_{5}w=w0fragmentsww0w=w_{0}w1fragmentsw1w_{1}w2fragmentsw2w_{2}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}w0=wfragmentsw0ww_{0}=ww1fragmentsw1w_{1}w5fragmentsw5w_{5}w4fragmentsw4w_{4}w3fragmentsw3w_{3}w2fragmentsw2w_{2}w𝑤wwfragmentsww^{\prime}s𝑠\scriptstyle sy𝑦yz=yfragmentszyz=y^{\prime}zfragmentszz^{\prime}w𝑤wwfragmentsww^{\prime}y=yfragmentsyyy=y^{\prime}z=zfragmentszzz=z^{\prime}s𝑠\scriptstyle swfragmentsww^{\prime}w𝑤ww𝑤ww𝑤wwfragmentsww^{\prime}wfragmentswfragmentsw^{\prime\prime}55\scriptscriptstyle 544\scriptscriptstyle 43fragments3\scriptscriptstyle 3^{*}33\scriptscriptstyle 322\scriptscriptstyle 21fragments1\scriptscriptstyle 1^{*}11\scriptscriptstyle 100\scriptscriptstyle 01¯¯1\scriptscriptstyle\overline{1}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}2¯¯2\scriptscriptstyle\overline{2}3¯¯3\scriptscriptstyle\overline{3}3¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 53¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 5w𝑤wwfragmentsww^{\prime}wfragmentswfragmentsw^{\prime\prime}77\scriptscriptstyle 766\scriptscriptstyle 65fragments5\scriptscriptstyle 5^{*}55\scriptscriptstyle 544\scriptscriptstyle 43fragments3\scriptscriptstyle 3^{*}33\scriptscriptstyle 322\scriptscriptstyle 21fragments1\scriptscriptstyle 1^{*}11\scriptscriptstyle 100\scriptscriptstyle 01¯¯1\scriptscriptstyle\overline{1}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}2¯¯2\scriptscriptstyle\overline{2}3¯¯3\scriptscriptstyle\overline{3}3¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 55¯¯5\scriptscriptstyle\overline{5}4¯¯4\scriptscriptstyle\overline{4}3¯fragments¯3\scriptscriptstyle\overline{3}^{*}3¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 51p𝑝p1p~~𝑝\widetilde{p}00000000110w𝑤w0000000wfragmentsww^{\prime}0000000000111111111111111111111111111000000100001001000010100000zfragmentszz^{\prime}w=u0fragmentswu0w=u_{0}u1fragmentsu1u_{1}u2fragmentsu2u_{2}u3fragmentsu3u_{3}u4fragmentsu4u_{4}u5fragmentsu5u_{5}AfragmentsA\scriptstyle A^{\prime}AfragmentsAfragments\scriptstyle A^{\prime\prime}wfragmentsw\scriptstyle w^{\prime}0000001p𝑝p1p~~𝑝\widetilde{p}11111122222200000000000000111112121001212122222222112222112212212211000000100110021021011002102011000000X𝑋Xz𝑧zz1fragmentsz1z_{1}z5fragmentsz5z_{5}z4fragmentsz4z_{4}z3fragmentsz3z_{3}z2fragmentsz2z_{2}w𝑤ww1fragmentsw1w_{1}w2fragmentsw2w_{2}w3fragmentsw3w_{3}w4fragmentsw4w_{4}w5fragmentsw5w_{5}
Figure 14. 3-shell of wfragmentsH𝑤\mathcal{H}_{w}: w𝑤w of Type 1

1. Consider first w𝑤w of Type τ=1fragmentsτ1\tau=1. We need to analyze the elements on or inside the 4τ=3fragments4τ34-\tau=3-shell of wfragmentsH𝑤\mathcal{H}_{w}. Label the simple reflections s,t,ufragmentss,t,us,t,u so that w<wsfragmentswwsw<ws, w>wtfragmentswwtw>wt, and w>wufragmentswwuw>wu. The alcoves associated to the six elements wrfragmentswrwr for rR(w)=t,ufragmentsrR(w)t,ur\in R(w)=\langle t,u\rangle form a small regular hexagon H𝐻H.

(i) Assume first that H𝐻H lies entirely within the chamber containing w𝑤w. Adjoin to H𝐻H the additional alcove corresponding to z:=wtuts=wutus=t(α)wfragmentszassignwtutswutust(α)wz:=wtuts=wutus=t(-\alpha)w, and call the resulting region X𝑋X. (Its shape is the unique convex pentagonal “heptiamond.”) We use X𝑋X to help describe the 333-shell of wfragmentsH𝑤\mathcal{H}_{w}, as follows. Reflect X𝑋X across the three lines Hα,ifragmentsHfragmentsα,iH_{\alpha,i}, Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}, and Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k} in the same fashion as was used to define the vertices of wfragmentsH𝑤\mathcal{H}_{w} in (4.1), forming five additional copies of X𝑋X; see Figure 14. It is clear that the hexagon zfragmentsH𝑧\mathcal{H}_{z} coincides with the 3-shell of wfragmentsH𝑤\mathcal{H}_{w}; indeed, w=t(α)zfragmentswt(α)zw=t(\alpha)z. By Corollary 5.2, qyw>0fragmentsq𝑦𝑤0q_{y}^{w}>0 for all yzfragmentsyzy\leq z. So if qxw>0fragmentsq𝑥𝑤0q_{x}^{w}>0 “because” x𝑥x lies on or inside the 3-shell of w𝑤w, and if yxfragmentsyxy\leq x, then yxzfragmentsyxzy\leq x\leq z implies qyw>0fragmentsq𝑦𝑤0q_{y}^{w}>0.

Hα2,0fragmentsHfragmentsα2,0H_{\alpha_{2},0}Hα2,1fragmentsHfragmentsα2,1H_{\alpha_{2},1}00Hα1,0fragmentsHfragmentsα1,0H_{\alpha_{1},0}Hα1,1fragmentsHfragmentsα1,1H_{\alpha_{1},1}Hα~,0fragmentsHfragments~𝛼,0H_{\widetilde{\alpha},0}Hα~,1fragmentsHfragments~𝛼,1H_{\widetilde{\alpha},1}q𝑞qα1fragmentsα1\alpha_{1}α2fragmentsα2\alpha_{2}α~~𝛼\widetilde{\alpha}IIIIIIIVVVI012122012102012011b𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle bc𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle bq𝑞\scriptscriptstyle qa𝑎\scriptscriptstyle aa𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle aE𝐸\scriptstyle EEfragmentsE\scriptstyle E^{\prime}w𝑤we𝑒ew3fragmentsw3w_{3}w4fragmentsw4w_{4}w5fragmentsw5w_{5}w=w0fragmentsww0w=w_{0}w1fragmentsw1w_{1}w2fragmentsw2w_{2}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}w0=wfragmentsw0ww_{0}=ww1fragmentsw1w_{1}w5fragmentsw5w_{5}w4fragmentsw4w_{4}w3fragmentsw3w_{3}w2fragmentsw2w_{2}w𝑤wwfragmentsww^{\prime}s𝑠\scriptstyle sy𝑦yz=yfragmentszyz=y^{\prime}zfragmentszz^{\prime}w𝑤wwfragmentsww^{\prime}y=yfragmentsyyy=y^{\prime}z=zfragmentszzz=z^{\prime}s𝑠\scriptstyle swfragmentsww^{\prime}w𝑤ww𝑤ww𝑤wwfragmentsww^{\prime}wfragmentswfragmentsw^{\prime\prime}55\scriptscriptstyle 544\scriptscriptstyle 43fragments3\scriptscriptstyle 3^{*}33\scriptscriptstyle 322\scriptscriptstyle 21fragments1\scriptscriptstyle 1^{*}11\scriptscriptstyle 100\scriptscriptstyle 01¯¯1\scriptscriptstyle\overline{1}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}2¯¯2\scriptscriptstyle\overline{2}3¯¯3\scriptscriptstyle\overline{3}3¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 53¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 5w𝑤wwfragmentsww^{\prime}wfragmentswfragmentsw^{\prime\prime}77\scriptscriptstyle 766\scriptscriptstyle 65fragments5\scriptscriptstyle 5^{*}55\scriptscriptstyle 544\scriptscriptstyle 43fragments3\scriptscriptstyle 3^{*}33\scriptscriptstyle 322\scriptscriptstyle 21fragments1\scriptscriptstyle 1^{*}11\scriptscriptstyle 100\scriptscriptstyle 01¯¯1\scriptscriptstyle\overline{1}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}2¯¯2\scriptscriptstyle\overline{2}3¯¯3\scriptscriptstyle\overline{3}3¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 55¯¯5\scriptscriptstyle\overline{5}4¯¯4\scriptscriptstyle\overline{4}3¯fragments¯3\scriptscriptstyle\overline{3}^{*}3¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 51p𝑝p1p~~𝑝\widetilde{p}00000000110w𝑤w0000000wfragmentsww^{\prime}0000000000111111111111111111111111111000000100001001000010100000zfragmentszz^{\prime}w=u0fragmentswu0w=u_{0}u1fragmentsu1u_{1}u2fragmentsu2u_{2}u3fragmentsu3u_{3}u4fragmentsu4u_{4}u5fragmentsu5u_{5}AfragmentsA\scriptstyle A^{\prime}AfragmentsAfragments\scriptstyle A^{\prime\prime}wfragmentsw\scriptstyle w^{\prime}0000001p𝑝p1p~~𝑝\widetilde{p}11111122222200000000000000111112121001212122222222112222112212212211000000100110021021011002102011000000X𝑋Xz𝑧zz1fragmentsz1z_{1}z5fragmentsz5z_{5}z4fragmentsz4z_{4}z3fragmentsz3z_{3}z2fragmentsz2z_{2}w𝑤ww1fragmentsw1w_{1}w2fragmentsw2w_{2}w3fragmentsw3w_{3}w4fragmentsw4w_{4}w5fragmentsw5w_{5}H𝐻HHfragmentsHH^{\prime}zfragmentszz^{\prime}w𝑤wwfragmentsww^{\prime}p𝑝pp~~𝑝\widetilde{p}
Figure 15. 3-shell of wfragmentsH𝑤\mathcal{H}_{w}: w𝑤w of Type 1, adjacent to chamber wall

(ii) If H𝐻H does not lie entirely within the chamber of w𝑤w, then w𝑤w must be in a root strip adjacent to one of the fundamental root strips (i.e., a base case). If w𝑤w were to lie in an even chamber, then w𝑤w would be twisted spiral (Base Case 1), contrary to assumption. So w𝑤w is in an odd chamber (and in Base Case 3). Three of the alcoves in H𝐻H lie in the chamber, and the other three lie in the adjacent fundamental root strip. Reflecting H𝐻H in the other wall of this chamber produces a new hexagon HfragmentsHH^{\prime} lying entirely within its chamber. If wHfragmentswHw^{\prime}\in H^{\prime} corresponds to w𝑤w under that reflection, then HfragmentsHH^{\prime} consists of the alcoves for the six elements wrfragmentswrw^{\prime}r for rR(w)fragmentsrR(w)r\in R(w). Letting z:=wtuts=wutus=t(α)wfragmentszassignwtutswutust(α)wz^{\prime}:=w^{\prime}tuts=w^{\prime}utus=t(-\alpha^{\prime})w^{\prime} (where t(α)fragmentst(α)t(\alpha^{\prime}) is translation into the chamber of wfragmentsww^{\prime}), one checks that zfragmentsHfragmentsz\mathcal{H}_{z^{\prime}} is the 3-shell of wfragmentsH𝑤\mathcal{H}_{w} (provided the latter is non-empty); see Figure 15. Now the result of the theorem for x𝑥x on or inside the 3-shell of wfragmentsH𝑤\mathcal{H}_{w} follows as before.

Hα2,0fragmentsHfragmentsα2,0H_{\alpha_{2},0}Hα2,1fragmentsHfragmentsα2,1H_{\alpha_{2},1}00Hα1,0fragmentsHfragmentsα1,0H_{\alpha_{1},0}Hα1,1fragmentsHfragmentsα1,1H_{\alpha_{1},1}Hα~,0fragmentsHfragments~𝛼,0H_{\widetilde{\alpha},0}Hα~,1fragmentsHfragments~𝛼,1H_{\widetilde{\alpha},1}q𝑞qα1fragmentsα1\alpha_{1}α2fragmentsα2\alpha_{2}α~~𝛼\widetilde{\alpha}IIIIIIIVVVI012122012102012011b𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle bc𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle ca𝑎\scriptscriptstyle ab𝑏\scriptscriptstyle bq𝑞\scriptscriptstyle qa𝑎\scriptscriptstyle aa𝑎\scriptscriptstyle ac𝑐\scriptscriptstyle cb𝑏\scriptscriptstyle ba𝑎\scriptscriptstyle aE𝐸\scriptstyle EEfragmentsE\scriptstyle E^{\prime}w𝑤we𝑒ew3fragmentsw3w_{3}w4fragmentsw4w_{4}w5fragmentsw5w_{5}w=w0fragmentsww0w=w_{0}w1fragmentsw1w_{1}w2fragmentsw2w_{2}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}Hβ,jfragmentsHfragmentsβ,jH_{\beta,j}Hα,ifragmentsHfragmentsα,iH_{\alpha,i}Hγ,kfragmentsHfragmentsγ,kH_{\gamma,k}w0=wfragmentsw0ww_{0}=ww1fragmentsw1w_{1}w5fragmentsw5w_{5}w4fragmentsw4w_{4}w3fragmentsw3w_{3}w2fragmentsw2w_{2}w𝑤wwfragmentsww^{\prime}s𝑠\scriptstyle sy𝑦yz=yfragmentszyz=y^{\prime}zfragmentszz^{\prime}w𝑤wwfragmentsww^{\prime}y=yfragmentsyyy=y^{\prime}z=zfragmentszzz=z^{\prime}s𝑠\scriptstyle swfragmentsww^{\prime}w𝑤ww𝑤ww𝑤wwfragmentsww^{\prime}wfragmentswfragmentsw^{\prime\prime}55\scriptscriptstyle 544\scriptscriptstyle 43fragments3\scriptscriptstyle 3^{*}33\scriptscriptstyle 322\scriptscriptstyle 21fragments1\scriptscriptstyle 1^{*}11\scriptscriptstyle 100\scriptscriptstyle 01¯¯1\scriptscriptstyle\overline{1}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}2¯¯2\scriptscriptstyle\overline{2}3¯¯3\scriptscriptstyle\overline{3}3¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 53¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 5w𝑤wwfragmentsww^{\prime}wfragmentswfragmentsw^{\prime\prime}77\scriptscriptstyle 766\scriptscriptstyle 65fragments5\scriptscriptstyle 5^{*}55\scriptscriptstyle 544\scriptscriptstyle 43fragments3\scriptscriptstyle 3^{*}33\scriptscriptstyle 322\scriptscriptstyle 21fragments1\scriptscriptstyle 1^{*}11\scriptscriptstyle 100\scriptscriptstyle 01¯¯1\scriptscriptstyle\overline{1}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}2¯¯2\scriptscriptstyle\overline{2}3¯¯3\scriptscriptstyle\overline{3}3¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 55¯¯5\scriptscriptstyle\overline{5}4¯¯4\scriptscriptstyle\overline{4}3¯fragments¯3\scriptscriptstyle\overline{3}^{*}3¯¯3\scriptscriptstyle\overline{3}2¯¯2\scriptscriptstyle\overline{2}1¯fragments¯1\scriptscriptstyle\overline{1}^{*}1¯¯1\scriptscriptstyle\overline{1}00\scriptscriptstyle 011\scriptscriptstyle 11fragments1\scriptscriptstyle 1^{*}22\scriptscriptstyle 233\scriptscriptstyle 33fragments3\scriptscriptstyle 3^{*}44\scriptscriptstyle 455\scriptscriptstyle 51p𝑝p1p~~𝑝\widetilde{p}00000000110w𝑤w0000000wfragmentsww^{\prime}0000000000111111111111111111111111111000000100001001000010100000zfragmentszz^{\prime}w=u0fragmentswu0w=u_{0}u1fragmentsu1u_{1}u2fragmentsu2u_{2}u3fragmentsu3u_{3}u4fragmentsu4u_{4}u5fragmentsu5u_{5}AfragmentsA\scriptstyle A^{\prime}AfragmentsAfragments\scriptstyle A^{\prime\prime}wfragmentsw\scriptstyle w^{\prime}0000001p𝑝p1p~~𝑝\widetilde{p}1111112222220000000000000011111212100121212222222211222211221221221100000010011002102101100210201100000
Conversion to HTML had a Fatal error and exited abruptly. This document may be truncated or damaged.